KEGG   Lodderomyces elongisporus: LELG_01585Help
Entry
LELG_01585        CDS       T01116                                 

Definition
(RefSeq) similar to cyclin
  KO
K06634  cyclin H
Organism
lel  Lodderomyces elongisporus
Pathway
lel03022  Basal transcription factors
lel03420  Nucleotide excision repair
Module
lel_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    LELG_01585
  Replication and repair
   03420 Nucleotide excision repair
    LELG_01585
Transcription machinery [BR:lel03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     LELG_01585
DNA repair and recombination proteins [BR:lel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     LELG_01585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB
Motif
Other DBs
NCBI-GeneID: 5234465
NCBI-ProteinID: XP_001526757
UniProt: A5DW49
AA seq 418 aa AA seqDB search
MTEQLHDTKEDSPVRKKQRISADDLYRRSTQFEMWSFTPDQLAHAKITANTKGQNLASAK
FQEAYKLAKLQNPQVFQDNALELSEENLLNLLSPEEESTYLDFYIQNITTTCNFFKMPTQ
VKLTAASFFKKFYIVNSVMEFHPKNVLYTCIFLAAKSENYFISIDSFVKALKGVEKTDIL
SLEFILLQSLKFTLLVHHPMRPLYGFFLDFQAELLHPDPVMYDVSVDTIGKLYNSAKEWL
NKYYMFSDVGFLFAPPHIALAAMYDIDRRITDRYLKRKFLKHEKSEDRDNKERKEKKENK
ENGTNENQSMKHEADGKMTNDANSDPLPNEQNRSLENAEKAVEINGVETAKILPGREQYE
TLVRSIRKCIKLAREMPVADRERSKEIDRKCFFALNPKKLIDKRIKKLTTPPAEKTDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaactgcatgataccaaagaggattcacctgtgcgtaagaagcaaaggatc
tcggctgatgatttatacagaagatcaacacaatttgagatgtggtcgtttactccagat
caactagcacatgcgaaaatcaccgcaaatactaaaggtcagaatttagctagtgctaaa
tttcaagaagcttacaagttggcaaagctgcaaaatcctcaagtgtttcaagacaatgca
ctggaactcagcgaagagaaccttttaaaccttttgtcccccgaagaagagtcaacgtac
ctcgatttttacattcaaaatatcacaaccacatgtaattttttcaagatgcccacccag
gttaaactcactgcggcatctttctttaagaaattttatattgtcaattccgtcatggag
tttcatccaaagaatgtgctttacacatgcatttttcttgctgcaaaatctgaaaactat
tttatatcgattgactcatttgtcaaagcattaaagggtgtcgagaagacggatatcttg
agtttggagtttatcttattgcaaagtttgaaatttactttgctcgttcaccacccaatg
agaccattatacgggtttttcctagatttccaagcagagttattacatccagaccccgtg
atgtatgacgtttcggttgacacaattggaaagttgtacaactctgccaaggagtggttg
aacaaatattatatgtttagtgatgtaggatttttgtttgcgcctccgcacattgcgttg
gctgcaatgtatgacatcgacagaaggattaccgatcggtatttgaagcgaaaattccta
aagcacgaaaagtcggaggatagagacaacaaggaaagaaaggaaaagaaagagaataag
gaaaatggcactaacgagaatcaaagcatgaagcatgaagccgacggcaaaatgacaaat
gatgcaaatagtgacccgctgccgaatgagcagaaccgaagcttggaaaatgcagagaaa
gctgtggaaataaatggcgttgagaccgcaaagatactgcctggaagagagcaatatgaa
acattggttcgatcgatacgtaaatgcatcaagcttgcaagagaaatgcccgttgctgat
cgtgaacgaagtaaagagattgatcgcaaatgcttttttgcattgaatcccaaaaaattg
atcgacaagaggataaagaagttgacaacaccacctgcagaaaaaactgatctgtaa

DBGET integrated database retrieval system