KEGG   Lodderomyces elongisporus: LELG_03097Help
Entry
LELG_03097        CDS       T01116                                 

Definition
(RefSeq) heat shock protein SSB1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lel  Lodderomyces elongisporus
Pathway
lel03040  Spliceosome
lel04141  Protein processing in endoplasmic reticulum
lel04144  Endocytosis
lel04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lel00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LELG_03097
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LELG_03097
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    LELG_03097
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    LELG_03097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lel01009]
    LELG_03097
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lel03041]
    LELG_03097
   03009 Ribosome biogenesis [BR:lel03009]
    LELG_03097
   03110 Chaperones and folding catalysts [BR:lel03110]
    LELG_03097
   04131 Membrane trafficking [BR:lel04131]
    LELG_03097
   03051 Proteasome [BR:lel03051]
    LELG_03097
   03029 Mitochondrial biogenesis [BR:lel03029]
    LELG_03097
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lel04147]
    LELG_03097
Protein phosphatases and associated proteins [BR:lel01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LELG_03097
Spliceosome [BR:lel03041]
 Complex B
  Other components
   Prp19 complex
    LELG_03097
 Complex C
   Prp19-CDC5 complex
    LELG_03097
Ribosome biogenesis [BR:lel03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    LELG_03097
Chaperones and folding catalysts [BR:lel03110]
 Heat shock proteins
  HSP70 / DNAK
   LELG_03097
Membrane trafficking [BR:lel04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    LELG_03097
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    LELG_03097
Proteasome [BR:lel03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    LELG_03097
Mitochondrial biogenesis [BR:lel03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    LELG_03097
Exosome [BR:lel04147]
 Exosomal proteins
  Proteins found in most exosomes
   LELG_03097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C ATP-synt_DE DDR
Motif
Other DBs
NCBI-GeneID: 5232614
NCBI-ProteinID: XP_001525169
UniProt: A5E0G0
AA seq 613 aa AA seqDB search
MADGVFQGAIGIDLGTTYSCVATYDSAVEIIANEQGNRVTPSFVAFTSEERLIGDAAKNQ
AALNPRNTVFDAKRLIGRAFDDDSVQKDIKSWPFKVVEQNGQPQIEVEYLGESKTFSPQE
ISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLNITGGVFTVKATAGDTHLGGQDFDTNL
LEHFKKEFQKKTGSDISGDARALRRLRTACERAKRSLSSGTQTTVEIDSLFDGEDFSANI
TRARFEDINSALFKSTLDPVEQVLKDAKINKSQVDEVVLVGGSTRIPKVQKLLSDFFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTNDETKDLLLLDVIPLSLGVAMQGNVFAPVVPR
NTTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCSENTLLGEFDLKNIPPMQAGEPVLEA
IFEVDANGILKVTAVEKSTGRSANITISNSIGRLSTEEIEKMINDAEKFKSSDDAFAKRH
EQKQKLEAYVASVESTVTDPVLSAKLKKSAKDKIEAALSDALSTLEIEDSSADDYRKAEL
ALKRAVTKGMATR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggtgtttttcaaggtgctattggtatcgatttaggtaccacttactcatgt
gttgctacttacgactcagcagttgagatcatcgctaacgagcaaggtaacagagtcact
ccatctttcgtcgcttttactagtgaagagagattgattggtgatgccgccaagaatcaa
gctgctttgaacccaagaaacactgttttcgatgctaagcgtttgattggtagagctttc
gacgatgactctgtccaaaaggatatcaagtcatggccattcaaggttgttgagcaaaac
ggccaaccacaaattgaggttgagtacttgggtgagtcaaagaccttttcaccacaagaa
atctcatccatggttttgaccaagatgaaggagattgctgaagccaagattggtaagaag
gttgagaaggctgttattaccgttccagcttacttcaacgacgctcaaagacaagctacc
aaggatgctggtgccattgctggtttgaacgttttgagaatcattaacgagccaaccgct
gccgctattgcttacggtttgggtgctggtaaatccgagaaggagagacacgttttgatc
tttgacttgggtggtggtactttcgatgtctctttgttgaacatcactggtggtgttttc
actgttaaggctactgctggtgacactcacttgggtggtcaagatttcgacaccaacttg
ttggagcacttcaagaaggagttccaaaagaagactggttcagacatctcaggtgatgct
agagctttgagaagattgagaactgcttgtgaaagagcaaagagatcattgtcctcaggt
actcaaaccactgttgaaattgactcattgtttgacggtgaagacttttcagctaacatc
accagagctagattcgaagacattaactctgctttgttcaagtccaccttggacccagtc
gagcaagtcttgaaggatgccaagatcaacaagagccaagttgacgaagttgtccttgtt
ggtggttccaccagaattccaaaagtccaaaagttgttgtctgacttctttgacggtaag
caattggagaaatctatcaaccctgatgaggctgttgcttacggtgctgctgttcaaggt
gctatcttgaccggtcaatccactaacgatgaaaccaaggacttgttgttgttggatgtt
atcccattgtctcttggtgttgctatgcaaggtaacgtttttgccccagttgtcccaaga
aacaccactgttccaaccatcaagagaagaactttcaccaccgttgctgaccatcaaact
accgttcaattcccagtttaccaaggtgagcgtgttaactgtagtgaaaacactcttttg
ggtgaattcgacttgaagaacatcccaccaatgcaagctggtgaaccagtcttggaggct
atctttgaagttgacgccaacggtatcttgaaggttaccgctgttgaaaagtcaaccggt
agatctgctaacatcaccatctccaactccatcggtagattgtctactgaagagattgaa
aagatgatcaacgatgctgagaaattcaagtcatcagatgacgctttcgccaagagacac
gaacaaaaacaaaaattggaggcttacgttgcttcagttgagtccactgttaccgaccca
gtcttgagcgctaagttgaagaaatccgctaaggacaagatcgaggctgctttgtccgac
gctttgtcaaccttggaaatcgaagactcatctgctgatgactacagaaaggctgagttg
gctttgaagagagctgtcaccaagggtatggctactcgttaa

DBGET integrated database retrieval system