KEGG   Lodderomyces elongisporus: LELG_03471Help
Entry
LELG_03471        CDS       T01116                                 

Definition
(RefSeq) hypothetical protein
  KO
K17434  large subunit ribosomal protein L53
Organism
lel  Lodderomyces elongisporus
Brite
KEGG Orthology (KO) [BR:lel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lel03011]
    LELG_03471
Ribosome [BR:lel03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LELG_03471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 5232702
NCBI-ProteinID: XP_001525543
UniProt: A5E1I4
AA seq 91 aa AA seqDB search
MITKYFANVLVKFNPFSPAAKSSRLFLARVPASAKLNYKILDKETDIPEIKVEFKDKHVM
TANPAEMSLEELKEHFNSHSRRLSIKDAIME
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgattactaaatactttgcaaatgtgctggtgaaattcaacccgttctcacctgcggca
aaaagttcaagattattcctagctagagtaccagcaagtgcaaaattaaactacaagatc
ttggataaagaaactgacatacctgaaatcaaagtcgagtttaaagataaacatgtcatg
actgctaacccagcagagatgagcctagaagagcttaaggaacattttaatagtcattcg
aggaggttatcgattaaggatgctattatggaataa

DBGET integrated database retrieval system