KEGG   Lodderomyces elongisporus: LELG_03681Help
Entry
LELG_03681        CDS       T01116                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00260  Glycine, serine and threonine metabolism
lel00750  Vitamin B6 metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01230  Biosynthesis of amino acids
Module
lel_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LELG_03681
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LELG_03681
Enzymes [BR:lel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LELG_03681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 5232164
NCBI-ProteinID: XP_001524649
UniProt: A5E244
AA seq 504 aa AA seqDB search
MSSQVYRSTRSSQPEELSFEDVVMTGLAPDGGLYLPSSIPQLPSNFTETWKDLSFNELAF
EILRLYINELEIPSDDLKDLIKRSYATFRSDEVTPIKKLDDNLHILELFHGPTYAFKDVA
LQFVGNLFEYFLVRCNNKKKEGEPRDIITVVGATSGDTGSAAIYGLRGKKDVSVFILYPT
GRISPIQEEQMTTVEDANVHTLSVNGTFDDCQDIVKSIFGDKEFNDKYHVGAVNSINWAR
ILAQQTYYFYSYFQLQKQLGGNSKVRFVVPSGNFGDILAGYYAYKMGLPVDKLIIATNEN
DILDRFMKSGEYAKQQEVGVKVTYSPAMDILISSNFERLLWYLIRDNVANGNDEKAGEIL
SGWMKELKENGKFTAPQEVVEKARVVFDSDRVSNEDTIKTIKEVYSNNPEKYIIDPHTAI
GVKTSYRFIEKEPKAEYISLSTAHPAKFSEVVNKALESFDGYSFEKDVLPAELKALSTKE
KRIKLIDEPSIEKVKQAIKDELKF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacaagtttatagatccaccaggtccagccagccagaggaactctcctttgag
gatgtggtcatgaccgggttggcccccgatggaggtctttatttgccctcttcaatccca
caattaccatccaacttcactgaaacttggaaagacttgtcattcaacgagttggccttc
gagattttaagattgtacatcaacgaactggagatcccaagcgacgacttaaaggacttg
atcaagagatcgtatgctacattcagatctgatgaagttacaccaattaagaaattggac
gacaatttacacattttggagttattccatggtccaacatatgcctttaaggatgttgca
cttcaatttgtgggaaacttgtttgagtatttcttggtgagatgcaacaacaagaagaag
gaaggtgagccaagagacatcattaccgttgttggtgccacctctggagatactggttct
gctgccatttacggattgagaggtaagaaggatgtttctgtgttcatcttgtaccccact
ggaagaattagtcctattcaagaagagcaaatgactacagttgaagacgccaatgtacac
accctttccgttaatggtacttttgacgattgccaagatattgtcaaatcaatctttggt
gacaaggagttcaacgacaaataccatgttggtgcagtcaactccatcaactgggcaaga
atcttggcacaacagacttactacttctactcctacttccaattgcaaaaacaactcggt
ggaaactcaaaagtcagattcgttgttccatcaggtaactttggagacattttggcaggt
tactatgcatacaagatgggattgccagtggacaaattgattattgccacaaatgaaaac
gatatccttgacagatttatgaaatctggagaatatgcaaagcagcaagaagtcggtgtc
aaggtcacctactcgccagccatggacattttgatctcgtccaattttgaaagattgttg
tggtacttgatcagagacaatgttgccaacggcaatgacgagaaagccggcgagatcttg
agcggatggatgaaagagttgaaggaaaacggtaaatttacagcacctcaagaagttgtt
gaaaaagccagagttgttttcgactccgatagagtcagcaacgaggacaccatcaagacc
atcaaggaagtgtattcaaacaacccagaaaagtacatcattgacccacacacagcaatt
ggagtcaagacatcctacagattcatcgaaaaagaacctaaagcagaatacatctcgctc
tcgactgcccatccagccaagttctccgaggttgtcaacaaggcactcgagtcgtttgac
ggttactcttttgagaaggatgtacttccagcagagcttaaggctttgagcaccaaggaa
aagagaatcaagctcattgacgagccaagcatcgaaaaggtgaaacaggccatcaaagat
gagttgaagttttaa

DBGET integrated database retrieval system