KEGG   Lodderomyces elongisporus: LELG_03724Help
Entry
LELG_03724        CDS       T01116                                 

Definition
(RefSeq) hypothetical protein
  KO
K15529  ADP-ribose 1''-phosphate phosphatase [EC:3.1.3.84]
Organism
lel  Lodderomyces elongisporus
Brite
KEGG Orthology (KO) [BR:lel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LELG_03724
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.84  ADP-ribose 1''-phosphate phosphatase
     LELG_03724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro RRS1
Motif
Other DBs
NCBI-GeneID: 5231778
NCBI-ProteinID: XP_001524692
UniProt: A5E287
AA seq 160 aa AA seqDB search
MTVKYIRGDLFTHSAPTGKSIVLAHACNTGGSWGGGIAAVFARKYPKANRQYSEYCHKNS
HLLGTSLLLKADDYDKSKAYIACLFTSDFNQSPEQIVKYTDQSLQELAKQLKSLPIETQN
GNQVVNMPKINSGIFGVPWENTEAVLDKLDSLDFNVYVID
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaaatatattagaggagatcttttcactcatagcgctccaacagggaaatcc
attgtcttagcgcatgcatgtaataccggtggaagttggggtggaggaattgcagctgtt
tttgcaagaaagtaccccaaagcaaacagacagtatagcgagtattgccataagaatagc
catttactaggcacatcgctcttgctcaaagccgatgactacgacaaaagcaaagcatat
attgcgtgtctattcacaagtgactttaaccaatcaccagagcaaatagtaaaatacacg
gatcaatcgttgcaggaattagcaaagcagttgaaatcgttgcccattgagacacagaat
ggtaatcaagtagtcaacatgcccaaaatcaattcaggtatatttggtgttccttgggaa
aacacagaagcggtccttgataaacttgacagtttagactttaatgtatacgttattgat
tag

DBGET integrated database retrieval system