KEGG   Lodderomyces elongisporus: LELG_05241Help
Entry
LELG_05241        CDS       T01116                                 

Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00330  Arginine and proline metabolism
lel00332  Carbapenem biosynthesis
lel01100  Metabolic pathways
lel01130  Biosynthesis of antibiotics
lel01230  Biosynthesis of amino acids
Module
lel_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LELG_05241
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LELG_05241
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LELG_05241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 5230659
NCBI-ProteinID: XP_001523395
UniProt: A5E6K2
AA seq 424 aa AA seqDB search
MTKTSGHLTIVVKIGSSSLVDAVTREPRIANLAHIVETVTKLRRQGHRIVIVSSGAIAFG
MRVMNLSKKPTKLSEVQALASIGQGRLIGLFNSMFQQLGQTSSQILLTRNDINDFTQYRN
AQNTMDSLLEMGVIPIVNENDTLSVSEIKFGDNDTLSAITAGMVHADYLFLMTDVECLYL
DNPKTNPDAKPILVVDRVDELNVVTSEEAGSGVGTGGMTTKLIAAGLATSVGVTTIITLS
NQPHYILDIVAHIQSQKEVSITEQEQILQRDIDKKIIPLHTRFLSLPQLAKIKSDKKFWI
LHGLKTKGTLVIDQGCYAALTRRDRAGLLPAGIVDVVGNFHENECVSIKVIGSNTEEIGH
CRVNYSANEIRAIKGHKSNEIESILGYADSEYVAHRDSLAFPPLTPSESHVSLVNAGKEA
AKAV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaactagtggacacctcacgattgtggtcaagattggttcatcgtccttggtc
gatgctgtgacccgggagcctagaattgcaaacttagcccacatagtcgagactgttaca
aagctaaggcgacagggccataggattgtgattgtttcatctggtgctattgcatttgga
atgagggttatgaacttgagcaagaaacctacaaagctatcggaagtccaagccttggcg
tctattggacaagggagacttatagggttgtttaatagcatgtttcagcaattgggtcaa
accagtagtcagatattgttgactcgaaatgatataaatgactttacgcaatacagaaat
gcacagaatacgatggactctttattggagatgggcgtgatacctatagttaatgaaaat
gacacattatccgtttcagaaatcaagtttggtgataacgatacattatcggcaatcacg
gcaggtatggtgcatgcagactacttgtttctcatgacagatgttgaatgtctttacctg
gacaatccaaagaccaacccagatgcaaaaccaattttggtagttgatagagtagacgaa
ttgaacgtggtcactagtgaggaagcaggatccggcgttggcacgggaggaatgacgaca
aagttgattgctgctggcttagctaccagtgttggagtgactacaattattactttgtcg
aatcaacctcactatatactagacattgttgcgcatatccagtcgcaaaaagaggttagc
ataactgaacaagaacaaatattgcagcgagatatagacaaaaagattatcccattgcac
accaggttcttgagcttaccgcaactggcaaaaatcaagtcggataaaaagttttggatc
ttgcatgggttaaagaccaagggcacattggtgatagaccaaggttgctatgcggcattg
acaaggagggaccgtgctggtttattgcctgcaggtattgttgatgttgtgggcaatttt
catgaaaacgaatgtgtttcgatcaaagttattggtagcaatactgaagagattggacat
tgtcgtgttaactactctgctaatgaaatacgtgcaattaagggacacaagagtaatgaa
atcgagtctatattgggctatgcagatagtgagtacgttgctcatagagacagtttggca
tttccgccactcacgccttcagagtcacatgtatcattggtcaatgctggaaaggaagcg
gcaaaagcagtctag

DBGET integrated database retrieval system