KEGG   Lysobacter enzymogenes M497-1: LEN_0124Help
Entry
LEN_0124          CDS       T04598                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lem  Lysobacter enzymogenes M497-1
Pathway
lem00520  Amino sugar and nucleotide sugar metabolism
lem01100  Metabolic pathways
lem01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LEN_0124 (nagA)
Enzymes [BR:lem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LEN_0124 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: BAV95611
UniProt: A0A1J1ECD0
Position
complement(144568..145701)
Genome map
AA seq 377 aa AA seqDB search
MTATAFVNGRVLSERGFEPDLSVIVEDGYIVAVLPGPPPGGAQAVDLQGRYLAPGFIDTQ
VNGGGDVLFNDAPTVEGLRTIAQAHRRFGTTGMMPTLISDDVEVMLRAIAAVREAIAQGV
PGILGIHLEGPYLAPARKGVHDPDKFHTPGEDELDRIASLDNGKTLLTLAPERFDDATLR
ALAARGVLLSAGHTAADYERLRAAFANGVTGVTHLFNAMTPLGSREPGGVGACIDDPNAW
CGVIVDGEHVHDASLRIAIAAKPRGKIMLVTDAMPPVGGASEDFVLYGETMTCRDGKCTT
ASGTLAGSALDMAGAVRNTVQRLGLPLEEACRMASTYPAQFLGLDGEFGKILPGYRADLV
ALDDALFVRDSWIGGAR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacggctttcgtcaacggccgcgtgctcagcgagcgcggtttcgaacccgac
ctcagcgtgatcgtcgaggacggttacatcgtcgcggtgctgccgggcccgccgccgggc
ggcgcgcaggcggtcgatctgcaaggtcgctacctcgcgccgggcttcatcgacacccag
gtcaacggcggcggcgatgtattgttcaacgacgcgcccacggtcgaaggcctgcgcacg
atcgcccaggcgcatcgccgattcggcaccaccgggatgatgccgacgctgatcagcgac
gacgtcgaggtgatgctgcgcgcgatcgccgcggtacgcgaggccatcgcccagggcgtg
cccggcattctcggcatccacctggaaggcccgtacctggcgccggcgcgcaagggcgtg
cacgacccggacaagttccacaccccgggcgaggacgagctcgaccgcatcgcctcgctc
gacaacggcaagaccctgctgacgctggcgccggagcgcttcgacgacgccaccctgcgc
gcgctggccgcgcgtggcgtgctgctcagcgccggccacactgccgccgactacgagcgc
ctgcgcgcggcgttcgccaacggcgtcaccggcgtcacccacctgttcaatgcgatgact
ccgctcggcagccgcgaacccggcggcgtcggcgcctgcatcgacgatcccaacgcctgg
tgcggggtgatcgtcgacggcgaacacgtgcacgacgcctcgctgcgcatcgccatcgcg
gccaagccgcgcggcaagatcatgctggtcaccgatgcgatgccgccggtcggcggcgca
agcgaagacttcgtgctgtacggcgagaccatgacctgccgcgacggcaagtgcaccacc
gccagcggcaccctggccggctccgcgctcgacatggccggcgcggtgcgcaacaccgtg
cagcgcctgggcctgccgttggaggaagcctgccgtatggcctcgacctacccggcgcag
ttcctcggcctggacggcgagttcggcaagatcctgccgggctatcgcgccgacctggtc
gcgctggacgacgccctgttcgtgcgcgacagctggatcggcggcgcgcgctga

DBGET integrated database retrieval system