KEGG   Lysobacter enzymogenes M497-1: LEN_0614Help
Entry
LEN_0614          CDS       T04598                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
lem  Lysobacter enzymogenes M497-1
Pathway
lem00040  Pentose and glucuronate interconversions
lem00053  Ascorbate and aldarate metabolism
lem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LEN_0614
   00053 Ascorbate and aldarate metabolism
    LEN_0614
Enzymes [BR:lem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     LEN_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAV96101
UniProt: A0A1J1E529
Position
707259..708866
Genome map
AA seq 535 aa AA seqDB search
MSLRETGVREDVLIGGRWQPSLDAAGEFRAFDPTRAVEVGAAFPISGAQDARAALASACA
AADALAACAPARIAAFLDAYAAAIEADADALVELAHLETALPARPRLAEVELPRATGQLR
QAARAARERSWTQPIIDTAAGLRSHLAPLHKPVLIFGPNNFPFAFNAVAGSDFASAIAAR
NPVIAKVHPSHPGTSQRLAQLAHRALLDADLPAQSLQVLYHLDPALGLELAGDARLGALA
FTGSRRAGLALKAAADAAGVPAYLELSSINPVFLLEGALRERGEALAQEFFASCTLGVGQ
FCTNPGVVVVPRGEAGDRFVAAAAQRFAAAPAGTMFSRGVLDHLHAGVNAWRDAGAQQLG
GGEAADGEGYRVRPALLSSDAAAFVADQRLQGEAFGPASLIVRVDGIDEALQVAAALEGN
LTGTIYGGDSAEDDEDWRRLAGALRPRVGRLIDGRMPTGVAVSAAMNHGGPYPSTGHPGF
TAVGMPSAIRRFAALHCYDHVRAEALPEELRDRNPGGLSRWIDGRWTLDDIGANA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgcgaaaccggagtgcgcgaggacgtcctgatcggcggccgctggcaaccg
tcgctggatgcggccggcgagttccgcgccttcgatccgacccgcgcggtcgaagtcggc
gcggcgttcccgatctccggcgcgcaggacgcgcgcgccgcgctggcttcggcctgcgcg
gcggccgacgcgctggccgcgtgcgcgccggcgcgcatcgcggcgttcctggacgcgtat
gccgcggcgatcgaggcagatgccgatgcgctggtggaactggcgcatctggaaaccgcg
ctgccggccaggccgcgtttggccgaggtggaactgccgcgcgcgaccggccagttgcgc
caggccgcgcgcgcggcgcgcgaacgcagctggacccagccgatcatcgacaccgcggcc
ggcctgcgctcgcacctggcgccgctgcacaaaccggtgctgatcttcgggccgaacaat
ttcccgttcgcgttcaacgcggtggccggcagcgatttcgcctcggccatcgccgcgcgc
aacccggtcatcgccaaggtccatccctcgcatccgggcaccagccagcggctggcgcaa
ctggcccatcgcgcgttgctggatgcggatctgccggcgcagtcgctgcaagtgctgtat
cacctcgacccggcgctgggcctggaactggccggcgatgcgcgcctgggcgcgctggcc
ttcaccggcagccgtcgcgccggactcgcgctcaaggccgcggccgatgcggccggcgtg
ccggcgtatctggagttgtcgagcatcaacccggtgttcctgctcgaaggcgcgctgcgc
gagcgcggcgaagcgctcgcgcaggagttcttcgcctcgtgcacgctcggcgtcggccag
ttctgcaccaaccccggcgtggtggtggtgccgcgcggcgaggccggcgaccgcttcgtc
gctgcggctgcgcagcgtttcgccgccgcgccggcggggacgatgttctcgcgcggtgtg
ctcgatcacctgcacgccggcgtgaacgcgtggcgcgatgccggtgcgcagcagctcgga
ggcggcgaagccgcagacggcgagggctatcgcgttcgccctgcattgctgagcagcgac
gcagccgcattcgtcgccgaccagcgcctgcaaggcgaagccttcggccccgccagcctg
atcgtgcgcgtggacggcatcgacgaagcgctgcaggtggccgcggcgctggaaggcaat
ctcaccggcaccatctacggcggcgacagcgccgaggacgacgaggactggcgccgcctc
gccggcgcgttgcgtccgcgcgtgggccgcctgatcgacggacgcatgcccaccggcgtt
gcggtcagtgcggcgatgaaccacggcggcccgtacccgagcaccggtcatccgggcttc
accgcggtcggcatgcccagcgcgatccgccggttcgccgcgctgcattgctacgatcat
gtgcgcgccgaagcgttgccggaggagttgcgcgaccgcaatcccggcggcctgtcgcgc
tggatcgacggacgctggaccttggacgacatcggagcgaatgcatga

DBGET integrated database retrieval system