KEGG   Lysobacter enzymogenes M497-1: LEN_3032Help
Entry
LEN_3032          CDS       T04598                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lem  Lysobacter enzymogenes M497-1
Pathway
lem00071  Fatty acid degradation
lem00072  Synthesis and degradation of ketone bodies
lem00280  Valine, leucine and isoleucine degradation
lem00310  Lysine degradation
lem00362  Benzoate degradation
lem00380  Tryptophan metabolism
lem00620  Pyruvate metabolism
lem00630  Glyoxylate and dicarboxylate metabolism
lem00640  Propanoate metabolism
lem00650  Butanoate metabolism
lem00900  Terpenoid backbone biosynthesis
lem01100  Metabolic pathways
lem01110  Biosynthesis of secondary metabolites
lem01120  Microbial metabolism in diverse environments
lem01130  Biosynthesis of antibiotics
lem01200  Carbon metabolism
lem01212  Fatty acid metabolism
lem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LEN_3032
   00630 Glyoxylate and dicarboxylate metabolism
    LEN_3032
   00640 Propanoate metabolism
    LEN_3032
   00650 Butanoate metabolism
    LEN_3032
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LEN_3032
   00072 Synthesis and degradation of ketone bodies
    LEN_3032
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LEN_3032
   00310 Lysine degradation
    LEN_3032
   00380 Tryptophan metabolism
    LEN_3032
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LEN_3032
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LEN_3032
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LEN_3032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lem04147]
    LEN_3032
Enzymes [BR:lem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LEN_3032
Exosome [BR:lem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LEN_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAV98519
UniProt: A0A1J1E8H0
Position
3818778..3819953
Genome map
AA seq 391 aa AA seqDB search
MSDVVIVGAKRTAIGSFLGQFTGVPTPTLGSAAITGALEQAGVAADQVDEVIMGCVLPAG
LGQAPARQAALGAGLPAAVGCTTINKVCGSGMKAIMLAHDLIQAGSAKVVVAGGMESMTN
APHLLNNSRTGIRYGSAEFLDHMAWDGLTNPYDGKAMGVFGDATCAKYGYDRAAIDAYSE
ESVKRAQAAQSAGHFKDEIVSVTVKGRKGDVVVDADEEPAKIDVAKIPTLRPAFGKDGVL
TAAASSKISDGAAATALMSAEEAAARGLKPLARIVAHAGHAQAPEWFTTAPVKAISNVLE
KAGWKVEDVDLFEVNEAFSVVAMAPMTELGIAHDKLNVHGGAVALGHPIGASGARLVVTL
INALRIRGGKRGVASLCIGGGEATAIAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtcgtcatcgtcggtgccaagcgcaccgccatcggttccttcctcggccag
ttcaccggcgtccccaccccgaccctgggcagcgccgcgattaccggcgcgctggaacag
gccggcgtggccgccgaccaggtcgacgaagtgatcatgggctgcgtgctcccggccggc
ctcggccaggccccggcgcgccaggccgcgctcggcgccggcctgcccgccgcggtcggc
tgcaccaccatcaacaaggtctgcggctcgggcatgaaggcgatcatgctcgcccacgac
ctgatccaggccggctcggccaaggtcgtcgtcgccggcggcatggagtcgatgaccaac
gccccgcacctgctcaacaactcgcgcaccggcatccgctacggcagcgccgagttcctc
gaccacatggcctgggacggcctgaccaacccgtacgacggcaaggccatgggcgtgttc
ggcgacgccacctgcgccaagtacggctacgatcgcgccgccatcgacgcctattccgaa
gagagcgtgaagcgcgcgcaggctgcgcagtcggccggccacttcaaggatgaaatcgtt
tccgtgacggtcaagggccgcaagggcgatgtcgtcgtcgacgccgacgaagagcccgcc
aagatcgacgtggccaagattccgaccctgcgtccggcgttcggcaaggacggcgtgctg
accgccgcggcctcctcgaagatctccgacggcgccgccgcgaccgcgttgatgagcgcc
gaagaagccgccgcgcgcgggctcaagccgctggcgcgcatcgtcgcccacgccggccac
gcgcaggcgccggaatggttcaccaccgcgccggtgaaagcgatttcaaacgtgctcgaa
aaggccggttggaaggtcgaagacgtcgatctgttcgaggtcaacgaagcgttttcggtg
gtcgcgatggcgccgatgaccgagctgggcatcgcccacgacaagctcaacgtgcacggc
ggcgcggtcgcgctgggccacccgatcggcgccagcggcgcccgcttggtggtcacgctg
atcaatgccttgcgcatccgcggcggcaagcgcggcgtcgcctcgctgtgcatcggcggc
ggcgaagccacggcgatcgccatcgaattgctgtaa

DBGET integrated database retrieval system