KEGG   Leptolyngbya sp. NIES-3755: LEP3755_30080Help
Entry
LEP3755_30080     CDS       T04199                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00770  Pantothenate and CoA biosynthesis
len01100  Metabolic pathways
Module
len_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:len00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LEP3755_30080
Enzymes [BR:len01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     LEP3755_30080
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     LEP3755_30080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: BAU12479
UniProt: A0A0S3U4U3
Position
complement(3098851..3100053)
Genome map
AA seq 400 aa AA seqDB search
MAKRVLIGISGGIAAYKVCNVVSALAKEGIEVKVILTDSAQEFVSPLTFATLSRNSAYVD
RQFWDASNPRPLHIELGEWADLFVIAPLTANTLAKLAYGMADNLLTNTVLASVCPVLLAP
AMNTDMWEQRSTQRNWKELLSDPRYHSADPGSGILACDRVGTGRMAEPEELLVQIRSLLH
TNGKRDLAGKNILISAGGTREHFDPVRFIGNPSTGKMGIAIAQAALHRGAQVTLVHAPID
AHLLAPIQNVRLVPVTSSAEMQQAMKEHFSIADYIVMSAAVGDVRSDLYSDSKLPKEQLP
KSLELVSIPDIVAELSTLKKPHQTLIGFAAQTGDYVTPAIDKLKRKNLDAIVANPVDQPN
SGFGSDTNQAVMIDRSGHQLTIPPCSKLELAHQLFDFMNS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaacgagttctaattggcatcagtggcggaattgcagcttataaagtgtgcaat
gtggtttcagcattagcaaaagagggaatcgaagtaaaagtcattctcacggattctgct
caagaatttgtttcgcctttgacgtttgcaacactgagtcgaaattcagcttatgtcgat
cgacaattttgggatgcttctaatcctcgtcctttacacattgaactcggtgaatgggcg
gatctgttcgtgattgctcctttgactgcgaatacgttagcaaaactcgcttatggtatg
gcggataatttgctgacgaatacggttcttgcttcggtttgtccggtgttgttagcacct
gcaatgaacacggacatgtgggaacagagatcgacacaacgcaactggaaagaattgctt
tctgatcctcgatatcattcggctgatccaggctctggaattctggcttgcgatcgcgtt
ggaaccgggcgcatggcagaaccggaagaattgttagtacagattcgatcgctgttacat
acgaatggaaaacgagatttagcaggaaaaaatatcttaatcagtgcaggaggaacacgc
gagcactttgatccagtgcggtttattggcaatccttcgactggaaaaatgggaattgcg
atcgctcaagctgctttacatcgaggcgcacaagttaccttagttcacgccccaattgat
gctcatcttctcgccccaattcaaaatgttcgtctcgttcctgtgactagctccgcagaa
atgcagcaagcaatgaaagagcattttagtatcgcggattatattgtgatgtctgctgct
gtaggtgatgttcgatctgatctttatagtgattccaaacttccgaaagagcagttgcca
aaatcattagagttagtgtcgattcctgatatcgtggctgaactatccacattgaagaaa
ccacatcagactttgattggatttgcggcacagacgggcgactatgtgacccctgcgatc
gacaaactaaagcgaaagaacttagatgcgatcgttgcgaatccggttgatcaacccaac
agcggatttggcagtgatacgaatcaggcagtgatgatcgatcgatcaggtcatcaactt
acaattccaccttgcagcaagttagaactcgctcatcagctttttgattttatgaattcc
taa

DBGET integrated database retrieval system