KEGG   Leptolyngbya sp. NIES-3755: LEP3755_54150Help
Entry
LEP3755_54150     CDS       T04199                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
len  Leptolyngbya sp. NIES-3755
Pathway
len00480  Glutathione metabolism
len00590  Arachidonic acid metabolism
len01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:len00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LEP3755_54150
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LEP3755_54150
Enzymes [BR:len01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LEP3755_54150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAU14860
UniProt: A0A0S3UBC3
Position
complement(5426727..5427221)
Genome map
AA seq 164 aa AA seqDB search
MTTTQSPSIYDFAANSLEGQPVSLSTFKDKVLLIVNTASQCGFTPQYQGLQSIYTKYQNQ
GFEVLGFPCNQFGQQEPGSANEIQSFCEMRFGVTFPLFEKIDVNGANAHPLFKYLTKSAP
GIFGTEGIKWNFTKFLVDRSGKVVKRYPSTTKPEDIEKDIQALL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactacaacacaatcgccatctatctatgactttgcggcaaatagtctcgaaggtcag
cctgtttcattgagcacattcaaagataaagtgctgttgattgtgaatactgcaagtcaa
tgtgggtttacacctcagtatcaaggtctacagtcgatttataccaagtatcagaatcaa
ggctttgaagttttaggatttccttgtaatcaattcggacaacaagaacccggcagcgcg
aatgagatccaatcattctgtgagatgcgctttggtgtgacctttccattgtttgaaaaa
atcgatgtgaatggagcgaatgcacatccattgttcaagtatttgacgaaatctgcacct
ggaatttttgggacagaaggcatcaaatggaactttacgaagttcttagtcgatcgctct
ggaaaagtggtcaaacgctatccttctacaaccaagcctgaagatatcgaaaaagatatt
caagccttgttgtaa

DBGET integrated database retrieval system