KEGG   Leptotrichia sp. oral taxon 212: AMK43_08140Help
Entry
AMK43_08140       CDS       T04044                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
leo  Leptotrichia sp. oral taxon 212
Pathway
leo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:leo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMK43_08140
Enzymes [BR:leo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AMK43_08140
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AMK43_08140
    1.1.1.-  
     AMK43_08140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ALA96703
UniProt: A0A0K2JE28
Position
complement(1763384..1764421)
Genome map
AA seq 345 aa AA seqDB search
MKAARWHNRKDVRVEELEIPQPKANQIKIEVKYCGICGSDLHEYLGGPIFIPVDKPHPYT
GEKAPLVMGHEFSGEVVEVGPEITKFKVGDRVTVEPIHAKDGLKGKYNLDSNLNFIGLAG
GGGGFSEYVVVNEDQAHKLPDNVDFEQGALTEPAAVGLYAVRQSRIQAGDTAAVFGCGPI
GLLVIDALRAAGASRIFAVELSPERQAKAKELGAIVVDPSKEDAVESIRRQTGGGVNVSF
EVTGVPVVLQQSLEAAEKGGELVVVSIWEQPATIHPNEIVIQEKTMKGVIAYRDVFPKVL
ELMGKGYFSKDILVTKRIKLEDIVEEGFNALVKEKSQVKILVSPK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccagatggcacaacagaaaagatgtaagggttgaagaactggaaatacct
caaccaaaagcaaatcaaattaaaattgaagtaaagtactgcggaatctgtggaagtgat
ctccatgaatatttgggaggacctatttttattcctgtagataaaccgcatccatataca
ggtgaaaaagcaccattagttatgggacatgaattttctggtgaagttgtggaagtcggt
cctgaaataactaaatttaaagtaggggatagagttactgtagaacctattcacgcaaaa
gatggattaaaaggaaaatataaccttgattctaatttgaacttcataggtttagccgga
ggaggaggaggattctctgaatatgttgttgtaaatgaagatcaggctcataaattgccg
gataatgtagattttgaacagggagctttaacagaacctgcagcagttggtctgtatgca
gtaagacagagtagaatacaggctggagatactgcggctgtatttggttgtggtcctata
ggattattagttatagatgcattaagagcggcaggggcatcaagaatatttgcagtggaa
ttatcacctgaacgtcaggcaaaagcaaaagaattaggagcgatagtagtggatccttct
aaagaagatgctgtggaatcaatcagaagacaaactggtggtggagtaaatgtgtcattt
gaagtaacaggtgttccagtagtacttcaacaatcgcttgaagctgcagaaaaaggtggg
gaacttgtagtagtaagtatctgggaacagcctgcaacaattcatccaaatgaaatagta
attcaggaaaaaacaatgaaaggagttatcgcttatcgtgacgtattccctaaagttctt
gaattaatgggaaaaggatatttctctaaagatattctggtaactaaaagaattaaattg
gaagatatagtcgaagaaggatttaatgctcttgtaaaagagaaaagtcaagttaagatt
ttagtatcacctaaatag

DBGET integrated database retrieval system