KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_1270Help
Entry
Lepto7376_1270    CDS       T02361                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00020  Citrate cycle (TCA cycle)
lep00640  Propanoate metabolism
lep00660  C5-Branched dibasic acid metabolism
lep01100  Metabolic pathways
lep01110  Biosynthesis of secondary metabolites
lep01120  Microbial metabolism in diverse environments
lep01130  Biosynthesis of antibiotics
lep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lepto7376_1270
   00640 Propanoate metabolism
    Lepto7376_1270
   00660 C5-Branched dibasic acid metabolism
    Lepto7376_1270
Enzymes [BR:lep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Lepto7376_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFY37623
UniProt: K9PWX4
Position
complement(1420791..1422005)
Genome map
AA seq 404 aa AA seqDB search
MELLEYQAKQLFRQVGIPTLPSQVISDARELKQLQIPYPVVLKSQVSSGGRGKVGGIKSV
QNTIDAIAAARNIFNLAIAGQYPEVILAEAQYRSEQEIFLAVVLDYELQRPVLIGSAFGD
TNVDVNTLLANLHQVVIEGSFSPFYARHLLHKMGVSGELVISLSQIIQKMYELLLAKDLE
LIEINPLGIGQNGELMALGGKVLAHNTALRKHADIAKFGDRSMSDSPRKMTATGPLFWKH
DVTGGKIGIICVGVGAAALIWDTIHDQKGHPACCWILGPYDQSSMFVPQELETQMMAILE
QVKSLPQVDVLLLNLVADDEINQQILQHLATYIKQPSPVINRAPMGHQTTVTIPTVSEST
FPEVVVRCLPTIENTFDSSLYWETELSDAISRAIALSKQRNVRA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaattgctcgaatatcaagcaaaacaactctttcgtcaggtgggtattccgacgcta
ccgtcacaggtgatttccgatgcgcgcgagttgaaacagttgcaaattccctatcctgtt
gtgttaaagtctcaggtttctagtgggggacggggcaaggttggtggcattaaatcagtg
cagaatacgattgatgcgatcgccgcggcccgcaatatttttaatttggcgatcgctgga
caataccctgaggtgattttagctgaagcccaatatcgaagcgaacaggaaatcttttta
gcggtggtgttggactatgaattgcaacgaccagtcttaattggctctgcctttggcgat
acaaatgtcgatgtcaatactcttctggcaaatttacatcaggtggtcatcgaaggatca
ttttcacccttttatgcccgtcatctcctccataaaatgggcgtatcgggagaactggtg
atcagcctgagtcagattattcagaaaatgtatgagctattgctcgcgaaagatctcgaa
ctgattgaaattaatcccctcggcattggtcaaaatggtgaactgatggccctcggcggc
aaggttctcgcccacaatacagccttgcgtaaacatgcagacattgcgaagtttggcgat
cgctcaatgtctgatagccctcgcaaaatgaccgcaacaggccccttattttggaaacac
gatgtcaccggtggaaaaattggcattatttgtgtgggggtgggtgcggcagcacttatc
tgggacacgatccatgatcaaaaaggtcaccccgcttgttgctggattttaggcccctat
gatcaaagttcaatgttcgtaccccaagagctcgaaacacagatgatggcaattttagag
caagtaaaatcgttgccgcaggtggatgttttattgctaaatttggttgctgatgatgag
ataaatcaacaaattttgcaacatctggcgacctacataaagcaaccgagtcctgtgatt
aatcgggcacctatgggacatcagacgaccgttacaatacccactgtgtcagaatcgaca
tttccagaagtggtggtgcgatgtttacctaccattgaaaatacctttgatagttcgctc
tattgggaaactgagctcagcgatgctattagtcgggcgatcgccttgagtaaacaaaga
aatgttcgtgcgtag

DBGET integrated database retrieval system