KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_1678Help
Entry
Lepto7376_1678    CDS       T02361                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00670  One carbon pool by folate
lep01100  Metabolic pathways
lep01120  Microbial metabolism in diverse environments
lep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Lepto7376_1678
Enzymes [BR:lep01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Lepto7376_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AFY38012
UniProt: K9PZS9
Position
complement(1913846..1914757)
Genome map
AA seq 303 aa AA seqDB search
MTTCLRRAIENQEFVITAEVAPPKGGNPQHMVDMASLLKEKVHGVNVTDGSRAVMRMSSI
AASTVLLQNGIEPIFQMACRDRNVIGLQADLMGAYALGLRNMLALTGDPVKAGDHPKARP
VFDLESVRLLKLITKLNGGKDFNDKKLPDGALDLFAGAAVDPQLKSWYSIESRFAKKVES
GARFFQSQMITDFIRLEEFMSRVASQHNVPVLAGIFLLKSAKNAKFINRCVPGAQIPDSI
IERLEYADQPLEEGIKIAAEQVKIAKDLCQGVHLMAVKREDLIPKVLELAEISIKTDKPV
LVS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctgcctgcgacgtgccattgaaaaccaagaatttgtgatcactgctgaagtc
gctccccccaaaggtggcaatccccagcatatggtcgatatggcaagtttgctaaaagag
aaagtgcatggtgtcaatgtgactgatggaagtagggcagtgatgcgcatgtcatccatt
gctgcttctacggtgcttctacaaaatggtattgagccaatatttcagatggcttgccgc
gatcgcaatgtgattggtttgcaagcggatcttatgggagcctacgcccttggtctaaga
aatatgctggcgcttacaggggatcctgtcaaagcaggagatcatcctaaagctagacct
gtgtttgatttagagtccgtccgtctcttaaaattgattactaaattgaacggtggtaaa
gattttaacgataaaaaattaccagatggcgcacttgatttatttgcgggtgctgcggtc
gatccccaactaaaaagttggtacagtatcgaatcgcgttttgctaaaaaggtcgaatct
ggtgccaggtttttccaatcgcaaatgattactgatttcattcgcctagaagaatttatg
agccgtgtggcgagtcaacataatgtgccagtgcttgccggaatttttctgcttaaatct
gcaaaaaatgccaaatttattaatcgctgtgtccccggtgcacagattccagacagcatt
attgagcgtttagaatatgctgaccaacctttggaagaaggtatcaaaattgcagcggaa
caagtgaaaattgctaaagatttgtgccaaggggttcatttgatggcggttaagcgagaa
gatttaattccaaaagttttagagcttgcagaaatctctatcaagactgacaaacctgtt
cttgtttcttga

DBGET integrated database retrieval system