KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_1939Help
Entry
Lepto7376_1939    CDS       T02361                                 

Definition
(GenBank) UDP-glucuronate decarboxylase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00520  Amino sugar and nucleotide sugar metabolism
lep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lepto7376_1939
Enzymes [BR:lep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Lepto7376_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind KR adh_short NmrA
Motif
Other DBs
NCBI-ProteinID: AFY38253
UniProt: K9PYN5
Position
2207802..2208734
Genome map
AA seq 310 aa AA seqDB search
MRILVTGGAGFLGSHLIDRLMEAGHEVICLDNFYTGRKQNVLKWMRNPYFELVRHDITEP
IRLEVDQIYHLACPASPVHYQYNAIKTVKTNVIGTLNMLGLAKRVKARFFLASTSEVYGD
PEVHPQPETYWGNVNSIGIRSCYDEGKRMAETLTFDYHRSNDVDIRVVRIFNTYGPRMLP
NDGRVVSNFIVQALQGKPLTVYGDGSQTRSFCYVSDLVEGFIRLMEGDYIGPVNLGNPGE
YTILQLAETIQKMINPDAELIFEPLPQDDPKKRQPDITRARKYLNNWQPIIPLQEGLEKT
IAYFRDQLKE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcttgttacgggcggagctggtttccttggctcacacctcattgatcgctta
atggaagccggtcacgaagttatctgtctcgataacttttacacagggcgaaaacaaaat
gtgttgaagtggatgagaaatccctactttgagctggttcgccatgatatcaccgaaccg
attcgcctcgaagttgatcagatttatcatctcgcctgtccggcttccccagttcattac
cagtacaacgcgattaaaaccgttaaaacaaacgtgatagggactctaaatatgttgggt
ttagccaagcgcgtcaaagcacgctttttcttggcatcgacctcagaagtctatggcgat
ccggaagtccatccccagcccgaaacctactgggggaatgtcaactcaatcgggatccgc
tcctgctacgacgaaggcaaacgcatggccgaaaccctaacttttgattaccatcgttct
aatgatgtcgatattcgagtcgttagaatctttaatacctatggtcctcgaatgttacct
aacgatggtcgagtcgtcagtaactttatcgtccaggccctacagggaaaacctttaacg
gtttatggcgacggctcccaaacccgtagtttttgctatgtcagtgatttggtagaagga
tttatccgattaatggagggagactatatcgggccagtcaacctaggaaatcctggtgaa
tacacgattctacaactcgccgaaactatccaaaaaatgatcaatcctgatgctgagctt
atttttgagcctttgcctcaggatgacccaaagaaaagacagccggatatcactcgcgcc
agaaagtacttaaataactggcaaccaatcattccactccaagagggtctggaaaaaaca
atcgcctatttccgcgatcaactcaaggaataa

DBGET integrated database retrieval system