KEGG   Leptotrichia sp. oral taxon 498: BCB68_09625Help
Entry
BCB68_09625       CDS       T04995                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
leq  Leptotrichia sp. oral taxon 498
Pathway
leq00051  Fructose and mannose metabolism
leq00520  Amino sugar and nucleotide sugar metabolism
leq01100  Metabolic pathways
leq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:leq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BCB68_09625
   00520 Amino sugar and nucleotide sugar metabolism
    BCB68_09625
Enzymes [BR:leq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BCB68_09625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer NTP_transf_3 Profilin
Motif
Other DBs
NCBI-ProteinID: ASQ49158
UniProt: A0A222PBF1
Position
complement(1972316..1973434)
Genome map
AA seq 372 aa AA seqDB search
METKKINRVALIMAGGSGTRFWPLSTNEKPKQFLDLVSEKTMIKETVDRILKLIPSENIF
ISTNINYLEIVKKELPQIPVRNIIFEPMARDTAACIGYASQIIDKIMGNSIMAVLPSDHL
IEKEDEFLKSLEFAFEAAKGDRIITLGIRPSYPETGYGYIEYVKKNKSCEKKDGLCIYKV
KRFREKPNKELAEKYIEQGNFLWNSGIFVWKTKFILSEIKKHMDSHKSVLENIEKLLEKV
DLKEFHGEKLSSYVRDEFKNFEKISIDFGVMEHTKSVSVIPVNIGWNDVGSFKSLGDIFS
KDDKGNVVKSEKFEKIDSEGNIIINKENDKMIATIGLENIVIVNTKDALLVCHKDKSQEI
KKILDKIEKNKS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaaaaaaattaatagagttgccttgattatggcgggaggaagtggtactaga
ttttggcccttgtcgactaatgaaaagccgaagcaatttttggacttggtgtcggaaaag
acgatgattaaagagacagttgacagaattttgaaactgataccaagtgaaaatatattt
atttcaacaaatataaattatttggaaattgtaaaaaaggaattgccgcaaatacctgta
aggaatattatttttgagccaatggcacgggatactgcagcttgtattgggtatgcttcg
caaataattgacaaaattatgggaaatagcattatggctgtgttgccgtctgatcatttg
attgaaaaggaagatgagtttttaaaaagccttgaatttgcatttgaggcggcaaaggga
gacaggattattacgcttggaataagaccttcgtatcctgaaactgggtacggatatatt
gaatatgtgaaaaaaaataaaagttgcgagaaaaaagatgggctttgcatatacaaggtt
aagagatttagggaaaagccaaataaggaacttgcggaaaaatatattgagcagggaaat
tttttatggaatagcggaatatttgtctggaagacgaagttcattttgagcgagataaaa
aaacatatggattcgcacaaaagtgttttggaaaatattgaaaaattacttgagaaagtt
gatttaaaagagtttcatggagaaaaattgagtagttatgtcagagatgaatttaaaaat
tttgaaaaaatctcgattgactttggcgtgatggagcatacaaaatctgtgagtgtgatt
cctgtgaatattggttggaatgatgttggaagttttaagtcactgggagatattttttcc
aaagatgacaagggaaatgttgtaaaatctgaaaaatttgagaaaattgactctgaagga
aacattatcatcaacaaggaaaatgataaaatgattgcaacaattggactggaaaatatt
gttattgtaaatacaaaagatgcacttctggtctgtcataaggataaaagtcaggaaatt
aaaaagatactggataaaattgaaaaaaataaaagttaa

DBGET integrated database retrieval system