KEGG   Legionella endosymbiont of Polyplax serrata: CCU22_01440Help
Entry
CCU22_01440       CDS       T05191                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
les  Legionella endosymbiont of Polyplax serrata
Pathway
les00450  Selenocompound metabolism
les00970  Aminoacyl-tRNA biosynthesis
les01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:les00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CCU22_01440
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCU22_01440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:les01007]
    CCU22_01440
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:les03016]
    CCU22_01440
Enzymes [BR:les01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CCU22_01440
Amino acid related enzymes [BR:les01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CCU22_01440
Transfer RNA biogenesis [BR:les03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CCU22_01440
 Prokaryotic type
   Other AARSs
    CCU22_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Fungal_KA1 Ofd1_CTDD
Motif
Other DBs
NCBI-ProteinID: ATW01863
UniProt: A0A2D3R873
Position
complement(279464..281122)
Genome map
AA seq 552 aa AA seqDB search
MNKKNNSRQILVTTALPYANGLLHLGHLLEHIKSDIWVRTNRMIGNRCIFICGDDAHGTP
IMLCAKKLGISPEELIIDIKRSHESDFKDFYINYDYYHTTHSIENKKLVNFIYSRLLSNG
DINKKFICQFYDPIKKMFLPDRYVIGGCPRCSAKNQYGDHCTICGNVYNINDIVNPISSI
SGVSPIKKRSEHYFFSLSKYSLILQKWIKNREFLQKEILNKLNEWLLLGLKDWNISRDSP
YFGFKIPNDNSKKYFYVWFDASISYMSIFKKYCIDNNNLFWFNKYWNINSETELYHFIGK
DVIYFHYLFWPALLIASGYRLPTSIFVHGFLTINGKKMSKSSGTIIKASIYKKYLNPEYL
RYYFASKLNNTIEDIDLNFDDFLAKINSDLVGKVINIASRCSSFIKKYYSNQLSSMLDSA
ELYKDLLKNKSIIIESFLDHKYSIAISYIMKCADKSNWYINKKEPWIMIKNSSLLFEVHK
VCTMGLNLYRLLIGYLKPVLPNLAKMSEKFLNCGSLDWDSIENPILDIKINNFYPMIFRV
KKKDIDKVFLNN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaaaataatagtcgtcaaatattggttactactgcattaccatatgcaaat
ggtttattacatttaggacatttgcttgaacatattaaatctgatatttgggttcgtaca
aatagaatgattggaaatagatgtatttttatatgtggggatgatgctcatggtactcct
attatgttatgtgcaaagaaattgggtatttctcctgaggaattaattattgatataaaa
agatctcacgaatcagattttaaagatttttatataaattatgattattatcatactact
cattctattgaaaataaaaagttagttaattttatatattctcgtttattaagtaatgga
gatattaataagaaatttatttgtcagttttatgatcctattaaaaaaatgtttttacca
gatcgttatgttattggtggatgtcctagatgtagtgctaaaaatcagtatggagatcat
tgcacgatttgtgggaatgtttataatattaatgatattgttaatccgatatcttctatt
tctggagtttctccgataaaaaaaagatcagaacattattttttttctttatctaaatat
agtttgattttacaaaaatggattaaaaatagggaatttttgcagaaagagattttaaat
aaattgaacgaatggttattgttaggtttaaaagattggaatatatctcgtgatagtcct
tattttggatttaaaattcctaatgataatagtaaaaaatatttttatgtttggtttgat
gcttctataagttatatgtctatttttaaaaaatattgtatagataataataatttattt
tggttcaataaatattggaacattaattctgagacagaattatatcattttataggaaaa
gatgttatttattttcattatttattttggcctgctttattaattgccagtggttataga
ttgccaacatctatttttgttcatggttttcttactattaatggaaaaaaaatgtctaaa
tctagtggtactataattaaagcttcaatttataaaaaatatttaaatcctgaatattta
cgttattattttgcttcaaaattaaataatactattgaggatattgatttgaattttgat
gattttttagcaaaaataaattctgatttagttgggaaagtaattaatatagcaagtcgt
tgttctagttttataaaaaaatattatagtaatcaattatcgagtatgttagatagtgca
gagttatataaagatttgttaaaaaataaatctataattatagaatcatttttagatcat
aagtattcaatagctatttcatatattatgaagtgtgctgataaaagtaattggtatatt
aataagaaagaaccttggattatgattaaaaattcttctttattgtttgaagtacataaa
gtttgtacaatgggattaaatttatatcgtttattaattggatatttaaaacctgtactt
ccaaatttagctaaaatgagtgaaaaatttttaaattgtggttcattagattgggattct
atagagaatcctatattagatattaaaataaataatttttatcctatgatatttagagtt
aagaaaaaagatatagataaagtttttttaaataattaa

DBGET integrated database retrieval system