KEGG   Leptolyngbya sp. O-77: O77CONTIG1_00862Help
Entry
O77CONTIG1_00862  CDS       T04251                                 

Gene name
hddC_1
Definition
(GenBank) D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
let  Leptolyngbya sp. O-77
Pathway
let00051  Fructose and mannose metabolism
let00520  Amino sugar and nucleotide sugar metabolism
let01100  Metabolic pathways
let01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:let00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    O77CONTIG1_00862 (hddC_1)
   00520 Amino sugar and nucleotide sugar metabolism
    O77CONTIG1_00862 (hddC_1)
Enzymes [BR:let01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     O77CONTIG1_00862 (hddC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Motif
Other DBs
NCBI-ProteinID: BAU41055
UniProt: A0A0X8WSK4
Position
complement(962954..964120)
Genome map
AA seq 388 aa AA seqDB search
MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLRQHGFDEIMVNVSHLAYEI
ESYFRDGQRFGVQIAYSFEGRIVDGQLEGQAIGSAGGMRKIQDFAPFFDDTFVVLCGDAL
IDLNLTEAVRWHREKGAIATIIMKDVPREEVSSYGVVVTDESGRIQTFQEKPSIEEALST
TINTGIYIFEPEIFDYIPSGVEYDIGSELFPKLVEKGAPFYGISMDFEWVDIGKVPDYWH
AIRSVLRGEVKNVEIPGREVRPGIYTGINVAVNWDKVDIQGPVYIGGMTKIEDGARIVGP
SMIGPNCHICSGATVDNSVIFEYSRLGPGVRLVDKLVFGRYCVDKTGASIDVQAAALDWL
IADTRGDIPAETPIEHQAITELLSAETR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgatcctcgctgctggtaagggaactcgtgtgcgtcccatcacctacacg
attcccaaaccgatgattcccattctgcaaaagcccgtgatggagttcctgctagagctg
ctgcggcagcacggcttcgatgaaatcatggtgaacgtgagtcacctggcttacgaaatc
gagagctatttccgcgatggacagcgctttggcgtgcaaattgcctattcctttgaaggg
cggattgtggatggtcaactcgaaggtcaggctatcggttctgcgggcggaatgcggaag
attcaggactttgcgccgttttttgacgatacgttcgtggtgctgtgtggtgatgcgctg
atcgacctgaatttgaccgaggcggtgcgctggcatcgagaaaagggggcgatcgccacc
attattatgaaagatgtgccccgcgaagaggtgtcgagctatggggttgtggtcaccgat
gagtcgggccgcatccaaaccttccaggaaaagccctcgatcgaagaagccctcagcacc
acaatcaacaccgggatttatatctttgagccagaaatttttgactacattccttctggt
gtggaatacgacatcggcagtgagctattccccaagctggttgaaaagggcgcacccttc
tacggcatttcgatggattttgagtgggtggatattggcaaagtgcccgactattggcac
gccattcgcagcgtcttaaggggtgaggtcaagaatgtcgaaattcccggccgagaagtg
cgccccggcatctacacgggcatcaatgtcgccgtgaactgggacaaggtagacattcag
ggcccggtatacattggcggcatgaccaagattgaggacggcgcacgcattgtcggcccg
tcgatgattggccccaactgccacatttgcagcggcgcaacggttgataacagcgtgatt
tttgaatattcgcgcctagggcccggcgtgcgcctggtcgataagctcgtgtttggtcgc
tattgcgtagacaagacgggcgcatccatcgacgtgcaggcggctgcgctcgactggctg
atcgccgacacacggggcgacattcctgccgaaacgccgatcgagcatcaggcgattacg
gaactgctgagcgctgagactcgatag

DBGET integrated database retrieval system