KEGG   Leptolyngbya sp. O-77: O77CONTIG1_01324Help
Entry
O77CONTIG1_01324  CDS       T04251                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
let  Leptolyngbya sp. O-77
Pathway
let00630  Glyoxylate and dicarboxylate metabolism
let00710  Carbon fixation in photosynthetic organisms
let01100  Metabolic pathways
let01110  Biosynthesis of secondary metabolites
let01120  Microbial metabolism in diverse environments
let01130  Biosynthesis of antibiotics
let01200  Carbon metabolism
Module
let_M00165  Reductive pentose phosphate cycle (Calvin cycle)
let_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
let_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:let00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O77CONTIG1_01324 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O77CONTIG1_01324 (cbbS)
Enzymes [BR:let01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     O77CONTIG1_01324 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAU41514
UniProt: A0A110AVE5
Position
1470051..1470407
Genome map
AA seq 118 aa AA seqDB search
MKTLPKERRYETFSYLPPLTDAQIARQIQYTLDQGYFPCIEFNEDSAAEMHYWTMWKLPL
FNATSPQEVLNEVQQCRSEFPNCYIRVVAFDNIKQCQVMSFIVHKPGNNNNYGGGYRY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttacccaaagagcgccgttacgaaaccttttcctatctgcctccgttgacc
gacgcacaaattgcccgtcagatccagtacacgctcgaccagggttatttcccttgcatc
gagtttaatgaagattctgcggctgagatgcactattggacgatgtggaagctgccattg
tttaatgcgacttctcctcaagaggtgctgaatgaggtgcagcaatgccgttcagaattc
ccgaactgctatatccgggtggttgcgtttgacaatatcaagcagtgccaggtgatgagc
ttcattgttcataagcctggtaacaacaacaactacggcggtggctatcgctactaa

DBGET integrated database retrieval system