KEGG   Leptolyngbya sp. O-77: O77CONTIG1_01774Help
Entry
O77CONTIG1_01774  CDS       T04251                                 

Definition
(GenBank) 2-oxoglutaramate amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
let  Leptolyngbya sp. O-77
Brite
KEGG Orthology (KO) [BR:let00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O77CONTIG1_01774
Enzymes [BR:let01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     O77CONTIG1_01774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: BAU41956
UniProt: A0A0X8WTA0
Position
1977340..1978152
Genome map
AA seq 270 aa AA seqDB search
MRSYLAAAVQMNSVPDLEKNLAQAEDLIDLAVRQGAELIGLPENFSFLGDEDAKLAQAEA
IAQRSEKFLKTMAQRYQVTLLGGGFPVPTGTGKVYNTALLVDPSGSELARYEKVHLFDVN
LPDGNTYQESSIVLAGTQLPPVYPSKEFGNLGLSVCYDVRFPELYRHLAQMGAEVLFVPA
AFTAYTGKDHWQVLLQARAIENTCYVIAPAQTGKHNARRQSHGHAAIIDPWGLILAEVEE
KPGVAIASIEPSRLEQVRRQMPSLQHRVFI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagatcttatctagcggcagcagtgcaaatgaacagcgtgccagacctggagaaaaat
ctggctcaggcagaggatctaatcgacctggcggtgcgccagggggcagaactgattggg
ctgccggagaatttttcgtttttgggcgatgaagacgcgaagctggcccaggcagaggcg
atcgcccaacgcagcgaaaaatttctgaaaaccatggcccagcgctatcaggtgacgctc
ttgggtggcggcttcccggttcccacaggcacaggcaaggtctacaacacggctctgctc
gtagaccccagcggcagcgaactggcccgctatgaaaaagtgcatctgtttgatgtgaac
ctgcccgacggcaacacttatcaagagtcgagcattgtgctggcggggacgcagttgccg
ccagtctacccctccaaagagtttggcaacctggggctgtcggtctgctacgacgtgcgc
tttcccgaactctatcgccacctagcgcagatgggggccgaggtgctgtttgtgcctgct
gccttcaccgcctacacgggcaaagaccactggcaggttttgctccaggcgcgggcgatc
gaaaacacctgctacgtgattgcgcccgcccaaacgggcaagcacaatgcgcggcgacag
tctcacggacacgcggcgattatcgacccgtgggggctgattttggcagaagtagaagaa
aaacccggcgtggcgatcgcctccattgaaccctctcgcctggagcaagtgcggcggcag
atgccatccttgcagcaccgggtgtttatctag

DBGET integrated database retrieval system