KEGG   Leptolyngbya sp. O-77: O77CONTIG1_03082Help
Entry
O77CONTIG1_03082  CDS       T04251                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
let  Leptolyngbya sp. O-77
Brite
KEGG Orthology (KO) [BR:let00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O77CONTIG1_03082
Enzymes [BR:let01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     O77CONTIG1_03082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: BAU43255
UniProt: A0A120MWQ9
Position
3429043..3429978
Genome map
AA seq 311 aa AA seqDB search
MLELHCHTTYSDGTLTPAELVQAAAAAGVKALAITDHDTLAGWEEAIAAARQHSLENSLE
NSLEIVPGVELSTVWGDRSLHLLGFYPNPDRLAPVLQDHIAGRKRRAQQMLDKLAELGCP
IMLPELGAGMAPGRPHIASALVKAGYVQTAQEAFERFLGDDGPAYVQYEKFLATDGVRLL
RECGAVPVWAHPYLFRGGPLEETLTALLDAGLMGLEVYHPVPIRRVKLSDWKPCAIAILS
LKLAAATITAPGEAADQPLCPQPLQPAAVPAVAVATRCPIPRSPGPRVWSKIWVNRKIVT
PRLGFWVFLYL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctggaacttcactgccacaccacgtactctgacggaacgctgaccccagcggaactg
gtgcaggcggccgcagcggcgggcgtaaaggcgctggcgattactgaccacgacacgctg
gcgggctgggaggaggcgatcgccgctgcccgtcagcattctctagaaaattctctggaa
aattccctggaaatcgtccctggggtagagctgagtacggtttggggcgatcgctcgctg
cacctgctcggtttttacccaaaccccgacaggcttgcgcccgtgctgcaagaccatatc
gctggccgcaagcgccgtgcccagcagatgctcgacaagctagccgagttgggctgtccc
atcatgctgccagaactgggcgcgggcatggctccgggtcgcccccacattgccagtgcc
ttggtgaaggcgggctatgtgcaaacggcgcaggaagccttcgagcggtttttgggcgat
gacgggccggcctacgtgcaatacgaaaagtttttggcgacggacggcgtgcgtctgctg
cgcgagtgtggcgcagtgcccgtgtgggcccatccctatctgtttcgcggcgggccgcta
gaagagacgctgacggcgctgctggatgccggactcatgggtctggaggtgtatcacccc
gtccccatacgccgggtcaaattgagcgactggaagccctgtgcgatcgccattctctcc
ttaaaactggcggcagcgactatcacggcccccggcgaggctgccgaccagcccctatgc
cctcaaccgcttcaacctgccgctgtgcctgctgttgccgttgcaacgcgctgcccaatc
cctcgttccccaggcccgcgagtctggagcaagatctgggtcaataggaaaatagtcacg
cccagactgggtttctgggtcttcctatatctctag

DBGET integrated database retrieval system