KEGG   Leptolyngbya sp. O-77: O77CONTIG1_03089
Entry
O77CONTIG1_03089  CDS       T04251                                 

Definition
(GenBank) aspartoacylase
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
let  Leptolyngbya sp. O-77
Brite
KEGG Orthology (KO) [BR:let00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O77CONTIG1_03089
Enzymes [BR:let01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     O77CONTIG1_03089
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-ProteinID: BAU43262
UniProt: A0A0X8WW01
Position
3438800..3439717
AA seq 305 aa
MDRIRRVLLVGGTHGNELTGIYLIRRFQYAPQLISRPSFETMTLLSNLEAIAAGVRYIDQ
DMNRCCDRAHLELPDPVDYEIRRAQEINRRFGPSGSTPADVILDIHSTTSNMGMTLILDD
HHPFKLRLAAALSAQQPDLRIYSSADSGRQQDALRSLGRFGICLEVGPVAQGVLQADLFQ
RTEALVQQILDVLDQQNWDKPLPAVQPLTVYRYLGTVPYPRDAEGQITAMIHPQLQGQDY
ERLSPGDPMFLSLTGETLPYTGETVAFPVFINEAAYYEKDIAMVLTQRQEIQLGAIEPLS
TKPQE
NT seq 918 nt   +upstreamnt  +downstreamnt
atggataggattcggcgagtactgctggtcggcggcacacatggcaacgagttgacggga
atttacctgatccggagatttcaatacgctccccaactcatctcgcgccccagtttcgag
acaatgacactgctgagcaatctggaggcgatcgccgctggagtgcgttacatcgatcag
gatatgaaccgatgctgcgatcgcgcccatttggaactaccagaccccgtcgattatgaa
atccgtcgggcgcaagagatcaaccgccgctttgggccatccggctccacacctgccgat
gtcattctcgatatccacagcaccacgtcgaacatggggatgacgctaatcctggatgat
caccacccgttcaaactgagactggcagcagccctcagcgcccaacagcccgacctgcgg
atttacagttcggccgactcagggcgacagcaagacgcgctgcgatcgctcggtcggttt
ggtatttgcctggaggttggcccggtggctcagggcgtgctacaggcagacctgtttcag
cgcaccgaggcgctggttcagcaaatcctggatgtgctagaccagcaaaactgggacaaa
ccgttgcctgcggtacaaccgctaactgtttatcgatatttgggtacggtaccctacccc
agagatgccgagggacaaatcaccgctatgatccatccccaactccaggggcaggactac
gaaagactgagtcctggtgacccaatgtttctctcactcaccggagaaaccctgccctat
acaggcgaaaccgtcgcgtttcccgtgtttatcaacgaggccgcctactatgagaaagac
attgcgatggtgctaacgcagcggcaagagatccaattgggcgcgatagaaccgctatcc
acaaaaccgcaggaatag

DBGET integrated database retrieval system