KEGG   Leucobacter sp. DSM 101948: Leucomu_01915Help
Entry
Leucomu_01915     CDS       T05802                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
leu  Leucobacter sp. DSM 101948
Brite
KEGG Orthology (KO) [BR:leu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Leucomu_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QAB16857
UniProt: A0A410H7E0
Position
428183..429499
Genome map
AA seq 438 aa AA seqDB search
MELTLIVLLVIVLALFFDFTNGFHDTANAMATPIATGALKPKTAVLLAAILNLVGAFLST
EVAKTISGGLINEGDGGVLITPEMIFAGLIGAIVWNLLTWLYGLPSSSSHALFGGLIGAA
IVGAGISSVNGGVFLSKILIPMLAAPLTAGIVAFTATRVAYAITRRHDGKKDGRGRFRYA
QIASSSLIALAHGTNDAQKTMGVITLTLVAANLQDPGTGPHLWVITACALAIALGTYSGG
WRIIRTLGAGLTQVKPAQGFAAETSTAATILASSHLGFALSTTQVASGSVIGSGLGRRGS
SVRWRAVGRISLGWLFTLPASGVVAAVAALIAHIGPIGIVIDAVLGFGFILFIFWRSRRN
RVDHSNAIPVPDVAEAGYAVRVKKGKIKKVKTKTGTIPPLTPIAQSAARDDIAAREAVKA
AKEAAAEKRADEAREGDR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtggaactcactctcatcgtgctgctggtcatcgtgctggcactcttcttcgacttcacc
aacggctttcacgacaccgccaacgcgatggccacccccatcgcgaccggtgcgctcaag
ccgaagaccgcggtgctgctggccgcgatcctcaacctcgtgggcgccttcctctcgacc
gaggtggccaagaccatctcgggcggcctcatcaacgagggcgacggcggggtgctcatc
acccccgagatgatcttcgccggtctgatcggcgccatcgtctggaacctgctcacgtgg
ctctacgggctgccgtccagctcgtcgcacgcgctcttcggcggcctcatcggcgcggcc
atcgtgggcgccggcatctcgtccgtcaacggcggcgtcttcctttcgaagatcctgatc
ccgatgctcgccgcgcccctcaccgccggcatcgtcgcgttcacggcgacccgcgtcgcc
tacgcgatcacgcgccgccacgacggcaagaaggacggccgcggccgcttccgctacgcg
cagatcgcgtcgtcgtcgctgatcgcgctcgcgcacggcaccaacgacgcgcagaagacc
atgggcgtcatcacgctcacgctcgtcgcggcgaacctgcaggatcccggcaccggcccg
cacctctgggtgatcacggcctgcgcgctcgcgatcgcgctcggcacctactcgggcggc
tggcgcatcatccgcaccctcggggcgggcctgacccaggtgaagccggcgcagggcttc
gcggcagagaccagcaccgcggccacgatcctcgcctcgagccacctgggcttcgcgctc
tcgaccacgcaggtcgcctcggggtccgtgatcgggtccggcctcggccgtcgcggttcg
agcgtgcgctggcgcgcggtcggccgcatcagcctcggctggctcttcacgctgcccgcc
tcgggcgtcgtggcggccgtagccgcgctgatcgcgcacatcggcccgatcggcatcgtc
atcgacgcggtgctcggcttcggcttcatcctcttcatcttctggcgctcgcgccgcaac
cgcgtcgatcactcgaacgcgatcccggtgcccgacgtggccgaggccggttacgccgtg
cgcgtgaagaagggcaagatcaagaaggtcaagacgaagaccggcacgatcccgccgctc
accccgatcgcccagtcggcggcgcgcgacgacatcgccgcgcgcgaggccgtgaaggcc
gccaaggaggcggccgccgagaagcgcgcggacgaggcccgggagggtgaccgatga

DBGET integrated database retrieval system