KEGG   Leucobacter sp. DSM 101948: Leucomu_04430Help
Entry
Leucomu_04430     CDS       T05802                                 

Gene name
sucD
Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
leu  Leucobacter sp. DSM 101948
Pathway
leu00020  Citrate cycle (TCA cycle)
leu00640  Propanoate metabolism
leu00660  C5-Branched dibasic acid metabolism
leu01100  Metabolic pathways
leu01110  Biosynthesis of secondary metabolites
leu01120  Microbial metabolism in diverse environments
leu01130  Biosynthesis of antibiotics
leu01200  Carbon metabolism
Module
leu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
leu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:leu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Leucomu_04430 (sucD)
   00640 Propanoate metabolism
    Leucomu_04430 (sucD)
   00660 C5-Branched dibasic acid metabolism
    Leucomu_04430 (sucD)
Enzymes [BR:leu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Leucomu_04430 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: QAB17270
UniProt: A0A410H9E9
Position
937110..938012
Genome map
AA seq 300 aa AA seqDB search
MSIFLNKDSKVIVQGITGGEGTKHTARMLASGTDIVGGVNARKAGTTVTHTDQHGATVEL
PVFATVAEAMEKTGADVSVAFVPPAFTKDAAVEAIDAGIGLLVIITEGVPVKDSAELWAH
AKATGNKTRIIGPNCPGIITPDEALAGITPATITGKGPIGLVSKSGTLTYQMMYELRDLG
FSTAIGIGGDPVIGTTHIDALEAFEADPETKAIVMIGEIGGDAEERAAEFIKANVTKPVV
GYVAGFTAPEGKTMGHAGAIVSGSAGTAQAKKEALEAAGVKVGKTPTETAELLRQVFNAL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcttcctgaacaaggattccaaggtcatcgtccagggcatcacgggcggcgag
ggcaccaagcacaccgcgcgcatgctcgcgtcgggcaccgacatcgtcggcggggtgaac
gcgcgcaaggccggcaccacggtgacgcacaccgaccagcacggcgccaccgtcgaactg
cccgtattcgccaccgtcgcggaggccatggagaagacgggggccgacgtgtcggtcgcc
ttcgtgcccccggccttcaccaaggacgccgccgtcgaggccatcgacgcgggcatcggc
ctgctggtgatcatcaccgagggtgtgcccgtcaaggactcggccgagctgtgggctcac
gccaaggccaccgggaacaagacccggatcatcggcccgaactgccccggcatcatcacg
cccgacgaggcgctcgccggcatcacgcccgcgacgatcacgggcaagggccccatcggc
ctcgtctcgaagtcgggcaccctgacctaccagatgatgtacgagctgcgcgatctgggc
ttctcgaccgccatcggcatcggcggagaccccgtcatcggcacgacgcacatcgacgct
ctcgaggcgttcgaggccgatccggagacgaaggcgatcgtgatgatcggcgagatcggc
ggcgacgccgaggagcgcgcggccgagttcatcaaggccaacgtgacgaagccggtcgtc
ggctacgtcgcgggcttcaccgcgccggagggcaagaccatgggccacgccggcgccatc
gtgtccggctcggccggtaccgcccaggcgaagaaggaggctctcgaggccgccggcgtg
aaggtgggcaagacccccaccgagaccgccgagctgctgcggcaggtgttcaacgcgctg
taa

DBGET integrated database retrieval system