KEGG   Leucobacter sp. DSM 101948: Leucomu_09875Help
Entry
Leucomu_09875     CDS       T05802                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
leu  Leucobacter sp. DSM 101948
Brite
KEGG Orthology (KO) [BR:leu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Leucomu_09875
Enzymes [BR:leu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Leucomu_09875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: QAB18187
UniProt: A0A410HB94
Position
complement(2107911..2108711)
Genome map
AA seq 266 aa AA seqDB search
MRVAVAQTSPGIDADVNFATIRRYTAEAASRGARLVVFPEEAALLADDEIKPRFPEILRD
VWPRFEKLLAELAREHGVTIIAAGYEPNDAALPYNTILAFDPEGREIARYHKMHTYDAFA
YRESAYVTRGSELPPIIEVEGLRVGIANCYDVRFPELFRSMADRGVDVISLSAAWVSGKG
KEEHWEVLTKARAIENVSWFLASGTVGPDSVGLSRVIDPLGVVVATADAHDEGLVIADID
DGRTRGAREMLPALENRRIELDYSVQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagagtcgccgtcgcccagacgtcgcccggcatcgatgccgacgtcaacttcgccacc
atccgccgctacaccgcagaggcggcgtcccgcggcgcccgcctcgtcgtcttcccggag
gaggcggccctgctcgccgacgacgagatcaagccccgcttccccgagatcctgcgcgac
gtgtggccgcgcttcgagaagctgctggccgagctcgcccgcgagcacggtgtgacgatc
atcgccgccggctacgagccgaacgacgccgcgctgccgtacaacacgatcctcgccttc
gaccccgagggccgcgagatcgcccgctaccacaagatgcacacctacgacgccttcgcc
taccgggagtcggcgtacgtcacgcgcggatccgagctgcccccgatcatcgaggtcgag
gggctccgcgtcggcatcgcgaactgctacgacgtgcgcttccccgagctgtttcgcagc
atggccgaccgtggcgtcgacgtcatctcgctgtcggccgcctgggtgtccggcaagggc
aaggaggagcactgggaggtgctcaccaaggcccgcgccatcgagaacgtcagctggttc
ctcgcctccggcacggtcggccccgactccgtcgggctcagccgcgtgatcgaccccctc
ggcgtggtcgtcgcgacggccgacgcgcacgacgagggactcgtcatcgccgacatcgac
gacgggcgcacccgcggcgcccgcgagatgctgcccgccctcgagaaccgccgcatcgaa
ctcgactacagcgtccagtag

DBGET integrated database retrieval system