KEGG   Lelliottia sp. WB101: DAI21_03895Help
Entry
DAI21_03895       CDS       T05398                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
lew  Lelliottia sp. WB101
Pathway
lew00770  Pantothenate and CoA biosynthesis
lew01100  Metabolic pathways
Module
lew_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lew00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DAI21_03895 (coaBC)
Enzymes [BR:lew01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     DAI21_03895 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     DAI21_03895 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP LysR_substrate
Motif
Other DBs
NCBI-ProteinID: AVY96887
UniProt: A0A2S0PHY1
Position
820185..821399
Genome map
AA seq 404 aa AA seqDB search
MMSLAGKKIVLGVSGGIAAYKAPELVRRLRERGADVRVAITEGGKAFITPLSLQAVSGYP
VSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGMANDLVSTICLATPAPVA
VVPAMNQQMYRNAATQHNLDVLASRGLLIWGPDSGSQACGDIGPGRMLDPLAIVDMAAAH
FAPVNDLQHLNIMITAGPTREPLDPVRYITNHSSGKMGFAIAAAAAKRGATVTLVSGPVS
LPTPSSVQRIDVTTALEMEAAVQAHAQKQHIFIGCAAVADYRAETIADAKIKKQGDELTI
KMVKNPDIVAGVAALKMHRPYVVGFAAETNNVEEYARQKRTRKNLDLICANDVSLATQGF
NSDSNALYLFWQDGEKVLPLERKELLGQQLLDEIVTRYDEKNRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcctggccggtaaaaaaatcgttcttggcgtgagcggcggcattgccgcctat
aaagcgccagaactggtgcgccgtttgcgcgagcgcggggccgatgtgcgggtcgcgata
accgaaggcggcaaagcctttatcacgcccctgagtttgcaggcagtttctggatacccg
gtctctgacagcctgctggaccctgcggcagaagccgccatgggccatattgagcttggc
aaatgggcagacctggtgatcctcgcccccgcgacggctgatttaatcgcccgcgtcgct
gccggtatggcaaacgatctggtctctaccatttgcctggccacacccgctccggtcgcc
gtggttccggccatgaaccagcagatgtatcgtaacgccgctacccagcataatcttgac
gtgttggcctctcgcggcctgctgatttggggcccggacagcggcagtcaggcctgcggt
gatatcggcccaggccgtatgctagaccctcttgccattgtcgatatggctgcggcccat
tttgcccctgtcaacgacctgcaacatctcaacatcatgattacggcgggccccacgcgt
gaacccctggacccggtgcgttatatcaccaatcacagctccggtaagatgggcttcgct
atcgccgcagcggcggcaaaacgcggggcgacggtcacgctggtgagcgggccggtctcg
ttgcccacgccatcgtctgtgcagcgaatcgacgtaaccacagcgctggaaatggaagcc
gctgtccaggcgcacgcgcaaaaacagcacatatttatcggctgcgccgccgttgcggat
taccgcgcagaaaccattgctgacgcaaaaattaaaaagcaaggcgatgaattaacgata
aaaatggtgaaaaacccggatatcgtcgcgggcgttgctgcattaaaaatgcatcgacct
tacgtcgttggatttgccgcagaaacgaataatgtggaagaatacgcccggcaaaaacgt
acccgcaaaaatctcgatttgatttgtgcgaatgatgtatcgctggcgacacaaggattt
aatagcgacagcaatgcactgtaccttttctggcaggatggagagaaagtcttaccgctt
gagcgcaaggaactcctgggccaacaattactggacgagatcgttacccgttatgatgaa
aaaaatcgacgttaa

DBGET integrated database retrieval system