KEGG   Lelliottia sp. WB101: DAI21_16025Help
Entry
DAI21_16025       CDS       T05398                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
lew  Lelliottia sp. WB101
Pathway
lew00620  Pyruvate metabolism
lew00630  Glyoxylate and dicarboxylate metabolism
lew01100  Metabolic pathways
lew01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DAI21_16025
   00630 Glyoxylate and dicarboxylate metabolism
    DAI21_16025
Enzymes [BR:lew01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     DAI21_16025
    1.2.1.22  lactaldehyde dehydrogenase
     DAI21_16025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: AVY99047
UniProt: A0A2S0PP45
Position
complement(3326199..3327638)
Genome map
AA seq 479 aa AA seqDB search
MTVPVQHPMYIDGQFVAWQGETWIDVTNPATEEVISRIPDGRAEDARKAIEAAERAQAGW
EALPAIERANWLRKISAGIRERASEISALIVAEGGKIQQLADVEVSFTADYIDYMAEWAR
RYEGEILQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDDIGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVTAGEKIMTA
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINTGQVCNCAERVYVQKGIYDR
FVNRLGEAMKAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVQEGARVALGGKAVEG
KGYFYPPTLLLDVRQEMTIMHEETFGPVLPVVAFDSLDEALAMANDSEYGLTSSIYTQNL
TVAMQAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagtacccgtacaacatcctatgtatatcgatggacagtttgttgcctggcaaggt
gaaacctggattgatgtaaccaatcccgccaccgaagaggtcatttcccgtattcccgat
gggcgcgccgaagacgcccgcaaagcgattgaggctgccgaacgcgcgcaggccggctgg
gaagcgctcccggcgattgaacgcgccaactggctgcgcaaaatttccgccggtattcgc
gagcgcgccagtgagatcagcgccctgatcgtggccgaaggtggcaaaattcagcagctg
gccgacgtggaggtcagtttcaccgccgattacatcgactatatggccgaatgggcgcgc
cgctacgaaggggaaattcttcagagcgaccgtccgggcgagaacattttggtgtttaaa
cgtgcgctgggcgtaacgaccggcattctgccgtggaatttcccgttcttcctgattgca
cgcaagctggcacctgcgctgctgacgggcaacaccatcgtcatcaaaccgagcgaattc
acgccgaataatgcgattgcgtttgccaaaatcgtcgatgacatcggactgccaaaaggg
gtctttaacctggtgcttgggcgcggcgaaaccgtcgggcaggagctggcgggcaacccg
aaagtggcgatggtgagcatgaccggaagcgtcaccgccggggagaaaatcatgaccgct
gcggcgaaaaacatcaccaaagtgtgcctggagctgggcggcaaagcgcctgctatcgtg
atggatgacgcggatcttgagctggcggtgaaagcgattgtcgattcgcgcgtcattaac
accgggcaggtctgtaattgcgccgagcgcgtgtatgtgcaaaaaggcatttacgaccgc
ttcgtgaaccgtctgggtgaagcgatgaaagcggtgcagtttggcaatcccgctgagcgg
aatgatattgcgatgggcccgctgattaacgccgctgcccttgagcgcgtggaacaaaaa
gtggcgcgcgcggtgcaggaaggggccagagtggcgctgggtggcaaagcggtggaaggt
aaaggctatttctatccgccgacgctgctgctggatgtgcgccaggagatgaccatcatg
catgaagagaccttcgggccggtactgccggtggtggcgtttgattctctggatgaggcg
ctggcgatggctaacgacagtgagtatggcctgacctcgtccatttacacgcaaaatctg
actgtggcgatgcaagcgatcaaagggctgaagttcggcgagacctacatcaaccgcgag
aactttgaagcgatgcagggcttccatgcgggctggcggaaatcgggtatcggcggggca
gacgggaaacacggtctgcacgaatatctgcaaacccaggtggtgtatctacagtcgtaa

DBGET integrated database retrieval system