KEGG   Lysobacter enzymogenes C3: GLE_0048Help
Entry
GLE_0048          CDS       T04371                                 

Gene name
virB6
Definition
(GenBank) VirB6 protein
  KO
K03201  type IV secretion system protein VirB6
Organism
lez  Lysobacter enzymogenes C3
Pathway
lez03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lez00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GLE_0048 (virB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lez02044]
    GLE_0048 (virB6)
Secretion system [BR:lez02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   GLE_0048 (virB6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL
Motif
Other DBs
NCBI-ProteinID: ALN55407
UniProt: A0A0S2DAE2
Position
complement(53301..54362)
Genome map
AA seq 353 aa AA seqDB search
MLDIISAGLSDSLHLLRAGIPDGVDSLGFFALFKDFLDGEIAEYSRNLLRRVGTLVAVGV
TPLVTLWIIYQGYLRVTGQSHGSMAALKVEATRIVLIVTIAGASANFQDSIYKSMTDGVG
QVINYAISGEDKATVYDNIDQALALMQLATSSIDMLDVGENQVALKKRDQASLVAGLGVG
GPAVVGGCLLILNKFVIAMLLGVGPFFVLCLIFKQTEGLFKGWLNSLLGSLMAMAFLSVA
VTLAMDVTLALAGGFWAAEGLSRLLGMGTASEGINSVVQMQGILGLVLTTLIMGAPPAAA
MLFRGLLANFNPHSQFTGGGARSGDRAPSGYPQPPASSPPPPPPSGQQQVVVR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacatcatttcagccggcctgagcgacagcctgcacctgcttcgtgcggggatt
cctgacggagtcgatagcctcggctttttcgcactgttcaaggacttcctcgacggcgaa
atcgccgagtactcccgcaacctattgcgacgcgtcggcacgttggttgccgttggcgtt
accccgctggtaaccctgtggatcatctaccagggttatctcagggtaaccgggcagtcg
catggttcgatggcagcgctgaaagttgaggccacgaggatcgtcttgatcgtcacgatc
gctggcgcgtccgccaatttccaggattcgatctacaagtcgatgacggacggtgtcggt
caggtcatcaactacgcgatcagcggtgaagacaaggccactgtctacgacaacatcgat
caggcgctggctctgatgcaactggcaaccagcagcatcgacatgctcgacgtgggcgaa
aaccaagtcgccctcaagaagcgagatcaagccagtttggttgccgggctcggggtcggg
gggccggcggtggtcggcggatgcctcctcatcctgaacaagttcgtgatcgccatgttg
ctcggcgtcggcccgtttttcgttctctgcctaatcttcaagcagacggaggggctgttc
aagggctggctgaactcgttgctggggtctctaatggctatggccttcttgagcgtggcg
gtcactcttgcgatggacgtcacgctcgcactcgcaggagggttttgggcagctgaggga
ctgtcccgcctgctgggcatggggaccgcttctgaaggcatcaacagcgtggtccagatg
cagggcatcttgggactcgtcctcaccacgctcatcatgggagcgccacctgcggcggcg
atgttattcaggggactgctggccaacttcaacccccactcccagttcaccggcggcggt
gcccgcagcggagaccgcgccccgtcgggataccctcagcctcctgcatcctcccccccg
ccgccgccgccgtcaggtcagcagcaagtggttgttcgctag

DBGET integrated database retrieval system