KEGG   Lysobacter enzymogenes C3: GLE_3082Help
Entry
GLE_3082          CDS       T04371                                 

Gene name
hyr1
Definition
(GenBank) peroxiredoxin Hyr1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lez  Lysobacter enzymogenes C3
Pathway
lez00480  Glutathione metabolism
lez00590  Arachidonic acid metabolism
lez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    GLE_3082 (hyr1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GLE_3082 (hyr1)
Enzymes [BR:lez01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GLE_3082 (hyr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALN58429
UniProt: A0A0S2DJ45
Position
complement(3451453..3451938)
Genome map
AA seq 161 aa AA seqDB search
MTIAYDFSAVDIDGRDQSLDRYRGKVLLIVNVASKCGFTPQYTGLEKLQRDYQSRGFDVL
GFPCDQFGHQEPGDEAEIKEFCSLTYDVSFPMYSKVDVNGDKAHPLWKWLKDEKGGFLGI
DAIKWNFTKFLVGRDGRVLKRYAPTDKPESIAADIEKALAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgcctacgatttctccgccgtcgacatcgacggccgcgaccagtcgctcgac
cgttaccgcggcaaggtgctgctgatcgtcaacgtcgcctccaagtgcggcttcaccccg
cagtacaccggcctggaaaagctgcagcgcgactaccagagccgcggcttcgacgtgctc
ggcttcccctgcgaccagttcggccaccaggagccgggcgacgaggccgagatcaaggaa
ttctgctcgttgacctacgacgtgagcttcccgatgtacagcaaggtcgacgtcaacggc
gacaaggcgcacccgctgtggaagtggctcaaggacgagaagggcggcttcctcggcatc
gacgcgatcaagtggaacttcaccaagttcctggtcggccgcgacggccgcgtgctcaag
cgctatgcgccgaccgacaagcccgagtcgatcgcggcggacatcgagaaagcgctggcg
gcctga

DBGET integrated database retrieval system