KEGG   Lysobacter enzymogenes C3: GLE_3914Help
Entry
GLE_3914          CDS       T04371                                 

Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
lez  Lysobacter enzymogenes C3
Brite
KEGG Orthology (KO) [BR:lez00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GLE_3914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ALN59256
UniProt: A0A0S2DM62
Position
4410829..4411212
Genome map
AA seq 127 aa AA seqDB search
MNRPTEYVFDIDVATRYLDDQSAPEQDRYVFAYTIHIRNAGTVPARLISRHWVITDANGK
VQEVRGDGVVGEQPWLRPGDDFEYTSGAVLETSLGTMEGTYAMVADDGTRFDAPVPTFTL
TIPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccccaccgaatacgtcttcgacatcgacgtggcgacccgctacctggacgac
caatccgctccggagcaggatcgctacgtgttcgcctacaccatccacatccgcaacgcc
ggcaccgtgcccgcgcgcctcatctcgcgccattgggtgatcaccgacgcgaacggcaag
gtgcaggaagtgcgcggcgacggcgtggtcggcgagcagccgtggctgcgtccgggcgac
gacttcgaatacacctccggcgccgtgctggagaccagtctggggacgatggaaggcacg
tacgcgatggtcgccgacgacggcacccgcttcgacgcgccggtgccgacgttcaccctg
accatcccgcgtaccctgcactga

DBGET integrated database retrieval system