KEGG   Lysobacter enzymogenes C3: GLE_5043Help
Entry
GLE_5043          CDS       T04371                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lez  Lysobacter enzymogenes C3
Pathway
lez00071  Fatty acid degradation
lez00072  Synthesis and degradation of ketone bodies
lez00280  Valine, leucine and isoleucine degradation
lez00310  Lysine degradation
lez00362  Benzoate degradation
lez00380  Tryptophan metabolism
lez00620  Pyruvate metabolism
lez00630  Glyoxylate and dicarboxylate metabolism
lez00640  Propanoate metabolism
lez00650  Butanoate metabolism
lez00900  Terpenoid backbone biosynthesis
lez01100  Metabolic pathways
lez01110  Biosynthesis of secondary metabolites
lez01120  Microbial metabolism in diverse environments
lez01130  Biosynthesis of antibiotics
lez01200  Carbon metabolism
lez01212  Fatty acid metabolism
lez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GLE_5043
   00630 Glyoxylate and dicarboxylate metabolism
    GLE_5043
   00640 Propanoate metabolism
    GLE_5043
   00650 Butanoate metabolism
    GLE_5043
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GLE_5043
   00072 Synthesis and degradation of ketone bodies
    GLE_5043
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GLE_5043
   00310 Lysine degradation
    GLE_5043
   00380 Tryptophan metabolism
    GLE_5043
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GLE_5043
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GLE_5043
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GLE_5043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lez04147]
    GLE_5043
Enzymes [BR:lez01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GLE_5043
Exosome [BR:lez04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GLE_5043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HDPD
Motif
Other DBs
NCBI-ProteinID: ALN60384
UniProt: A0A0S2DPJ9
Position
complement(5618254..5619540)
Genome map
AA seq 428 aa AA seqDB search
MLPMRQNRPVAVLGGVRIPFCRQNTAYADVGNLGMSVRTLGALVEKFGLHGQQLGEVAMG
AVIKHSSDWNLGREAALSSGLSPLTPGITLQRACGTSLDSIITIANKIATGQIEAGIGGG
SDTTSDVPIVYGKSLRRRLLTAARAKTTKDKLAAFKGFHLRELKPEFPGVAEPRTGKSMG
DHCEDMAKQWNISRDSQDEWALSSHQKLAAAYERGFFDDLVVSFRGVSRDNVLRADSTLE
KLATLKPAFDKTSGRGTLTAANSTPLTDGAAACLLASEEWAQAHNQEVLCYLRDAQVAAV
DFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCKNRL
GLDAPLGRIDPAKINPNGSSLAAGHPFAATGARIVATAAKELKQRGGGRCLISICTAGGM
GVVAILER
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccgatgcgtcaaaaccgtcccgtcgccgtgctcggcggcgtgcgaatcccgttc
tgccggcagaacaccgcctatgcggacgtcggcaacctgggcatgtcggtgcgcacgctg
ggcgcgttggtcgagaagttcggcctgcacggccagcagctcggcgaagtggcgatgggc
gcggtgatcaagcacagcagcgactggaacctcggccgcgaggccgcgctgtcctccggg
ctgtcgccgctgaccccgggcatcaccctgcagcgcgcctgcggcacctcgctggattcg
atcatcaccatcgccaacaagatcgccaccggccagatcgaggccggcatcggcggcggt
tcggacaccacctccgacgtgccgatcgtctacggcaagagcctgcgccggcgcttgctg
accgcggcgcgggccaagaccaccaaggacaagctcgccgcgttcaagggcttccacctg
cgcgagctcaagcccgagttccccggcgtggccgagccgcgcaccggcaagagcatgggc
gatcactgcgaggacatggccaagcagtggaacatctcgcgcgactcgcaggacgagtgg
gcgctgtcctcgcaccagaagctcgccgccgcctacgagcgcggcttcttcgacgacctg
gtggtgagcttccgcggcgtctcgcgcgacaacgtcctgcgcgccgacagcacgctggaa
aagctggccacgctgaagccggcgttcgacaagacctccggtcgcggcaccctgaccgcc
gccaactcgaccccgctgaccgacggcgccgccgcgtgcctgctggcctcggaagagtgg
gcgcaggcgcataaccaggaagtgctgtgctatctgcgcgacgcgcaggtcgccgcggtc
gacttcgtccacggcgagggcctgctgatggcgccgaccgtggcggtgccggagatgctc
aagcgcaacggcctgaccctgcaggatttcgacatctacgaaatccacgaagccttcgcc
gcgcaggtgctgtgcacgctgcgcgcgtgggagagcgaggactactgcaagaaccggctc
ggcctggacgcgccgctgggccggatcgatccggccaagatcaacccgaacggctcctcg
ctggcggccgggcatcccttcgccgcgaccggcgcgcgcatcgtcgccaccgccgccaag
gagctcaagcagcgcggcggcgggcgttgcctgatctcgatctgcaccgccggcggcatg
ggcgtggtggcgatcctggagcgttga

DBGET integrated database retrieval system