KEGG   Legionella fallonii: LFA_0040Help
Entry
LFA_0040          CDS       T03771                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lfa  Legionella fallonii
Pathway
lfa00071  Fatty acid degradation
lfa00072  Synthesis and degradation of ketone bodies
lfa00280  Valine, leucine and isoleucine degradation
lfa00310  Lysine degradation
lfa00362  Benzoate degradation
lfa00380  Tryptophan metabolism
lfa00620  Pyruvate metabolism
lfa00630  Glyoxylate and dicarboxylate metabolism
lfa00640  Propanoate metabolism
lfa00650  Butanoate metabolism
lfa00900  Terpenoid backbone biosynthesis
lfa01100  Metabolic pathways
lfa01110  Biosynthesis of secondary metabolites
lfa01120  Microbial metabolism in diverse environments
lfa01130  Biosynthesis of antibiotics
lfa01200  Carbon metabolism
lfa01212  Fatty acid metabolism
lfa02020  Two-component system
Module
lfa_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LFA_0040
   00630 Glyoxylate and dicarboxylate metabolism
    LFA_0040
   00640 Propanoate metabolism
    LFA_0040
   00650 Butanoate metabolism
    LFA_0040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LFA_0040
   00072 Synthesis and degradation of ketone bodies
    LFA_0040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LFA_0040
   00310 Lysine degradation
    LFA_0040
   00380 Tryptophan metabolism
    LFA_0040
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LFA_0040
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LFA_0040
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LFA_0040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lfa04147]
    LFA_0040
Enzymes [BR:lfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LFA_0040
Exosome [BR:lfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LFA_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CEG55526
UniProt: A0A098G0N9
Position
I:complement(41571..42845)
Genome map
AA seq 424 aa AA seqDB search
MSFGKKVAILGSSRTPFVKSQTQYLGKSNQDLLGTALANLIDKTHIQGQLLGDLVAGAVM
NHPFDWNLAREVILGSTLSPDTPGLTIQRACGTGLESINIIALKIASGQIAVGIGGGTDT
NSDIPLIGQRTLTHFLIKYKQAKGFKERFAVLKKFRFNMLKPLLPEVREPRTKLSMGEHC
ELMVKEWQISRQAQDELALHSHHNAALAYDEGFYDDLIVPVAGLKRDGITRKDTTLQKLA
GLKTVFDRSDKGSLTAGNSTPLTDGAALVLLGSPQWAKTHNLDILAYFVDCEVAAVDFVH
GAGLLMAPTIAVNRLLARNKLSLQDFDYYEIHEAFAGQVLCTLKAWESADYCQKVLGRDQ
PLGSIDLQKMNVKGGSLALGHPFAATGGRIIGAAAKILANKEKGRLLISICTAGGMGVAA
IIER
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagttttggtaaaaaagtagctatccttggcagttcgcgtaccccatttgtcaaatcg
caaacccagtatttgggaaaatcaaatcaagacttattagggactgccttagctaatctg
attgataaaacgcatattcaaggtcaattattaggtgatttagttgctggtgcagtaatg
aatcatccttttgactggaaccttgctcgagaggtgatattaggcagcaccctatcgcca
gacacacctggtttaacaattcaacgagcctgtggcacgggactagagtccatcaatatc
atcgccttaaaaattgcaagtggccaaattgctgtagggataggtggcggaacagatacc
aattctgacattccccttattggtcaaagaacactgacgcattttttaatcaaatacaaa
caggcaaaagggtttaaagaacgctttgctgtgcttaaaaaatttcgtttcaatatgtta
aaaccattattgcctgaagtgcgtgagcctaggactaagctgtctatgggagaacattgt
gagctcatggttaaggaatggcaaattagtaggcaggctcaagatgagcttgccctacat
tctcatcacaatgctgccctagcttacgatgagggcttttacgatgatttaattgttccc
gttgcaggcttaaaacgcgatggcattacccgtaaggacacaaccttacaaaaacttgct
ggattaaaaaccgtttttgatcgctctgataagggtagtttaactgcagggaactcaact
cctttaacagatggtgcagcattagtgcttttaggctctccccaatgggctaaaacccat
aatttggatattctcgcctattttgttgattgtgaggtagctgctgtggattttgttcat
ggcgccggcctattaatggcacctactatagcggtaaaccgcttattagcaagaaacaag
ctaagccttcaagattttgattactatgaaattcatgaagcctttgcagggcaggtgctt
tgtacgttaaaagcctgggagtctgccgattattgccaaaaagtactaggccgagatcaa
cctttaggtagtattgatctacaaaaaatgaacgttaaaggaggcagccttgctttagga
catccctttgcagcaacaggggggcgtatcattggcgctgcagcaaaaattttagcgaat
aaagagaaaggtcggttattgatcagtatatgtactgccgggggtatgggggtagctgca
attattgagcgttaa

DBGET integrated database retrieval system