KEGG   Legionella fallonii: LFA_1652Help
Entry
LFA_1652          CDS       T03771                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lfa  Legionella fallonii
Pathway
lfa00071  Fatty acid degradation
lfa00072  Synthesis and degradation of ketone bodies
lfa00280  Valine, leucine and isoleucine degradation
lfa00310  Lysine degradation
lfa00362  Benzoate degradation
lfa00380  Tryptophan metabolism
lfa00620  Pyruvate metabolism
lfa00630  Glyoxylate and dicarboxylate metabolism
lfa00640  Propanoate metabolism
lfa00650  Butanoate metabolism
lfa00900  Terpenoid backbone biosynthesis
lfa01100  Metabolic pathways
lfa01110  Biosynthesis of secondary metabolites
lfa01120  Microbial metabolism in diverse environments
lfa01130  Biosynthesis of antibiotics
lfa01200  Carbon metabolism
lfa01212  Fatty acid metabolism
lfa02020  Two-component system
Module
lfa_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LFA_1652 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    LFA_1652 (fadI)
   00640 Propanoate metabolism
    LFA_1652 (fadI)
   00650 Butanoate metabolism
    LFA_1652 (fadI)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LFA_1652 (fadI)
   00072 Synthesis and degradation of ketone bodies
    LFA_1652 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LFA_1652 (fadI)
   00310 Lysine degradation
    LFA_1652 (fadI)
   00380 Tryptophan metabolism
    LFA_1652 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LFA_1652 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LFA_1652 (fadI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LFA_1652 (fadI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lfa04147]
    LFA_1652 (fadI)
Enzymes [BR:lfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LFA_1652 (fadI)
Exosome [BR:lfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LFA_1652 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CEG57059
UniProt: A0A098G4Y9
Position
I:complement(1813715..1815034)
Genome map
AA seq 439 aa AA seqDB search
MKQQSNLNGREVYVVDGNRTPFLKAKGIGPFTGSDLAVAAGSALLNRQPFSPTELDEVII
GCAMPSPDEANIARVVALRLGCGDKVPAFTVMRNCASGMQALDNAAMQIASGRSNLVLAG
GADAMSHAPLLFNQKMAGWLASWFAAKSFGQKFGLVTQFRPSYLAPVIALLRGLTDPIVG
LNMGQTAEKVAYKFNITRAQMDEFAVQSHLKLDAAYNEHRMSEVTPIIDSKGRIHPQDDG
IRVDSTVEKLAKLKPIFDKKYGMVTAGNSSQVTDGACLLLLASAEAVKKHGLQVIGRIVD
SQWAALDPSQMGLGPVHAATPILQRHKLRPEDMDCWEINEAFAAQVLGCVAAWSDEHYCK
EQLGLKEAMGAPSLDKLNRDGGAVAAGHPIGASGARIVLHVLKSLEQRNESRGMAAICIG
GGQGGAMYLERVTEVNGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcagtcaaatttaaatggtcgagaggtttatgtagtggatggaaatcgtacc
ccattcctaaaagcaaaaggaatagggccattcaccggctctgatttggcagtggctgct
gggtcggctttgttaaatcgacaaccgttttctcctactgaattggatgaagtaattatt
ggttgcgcaatgcccagccctgatgaagcaaatatagctcgtgttgttgcattgagatta
ggctgcggtgataaagtacctgcctttactgtaatgagaaattgtgcatcaggaatgcaa
gctctggataatgctgctatgcaaattgctagtggacgcagcaatctagttcttgcaggg
ggagcagatgccatgagtcatgctcccttgttattcaaccaaaaaatggctggatggctt
gctagttggtttgcagccaagagctttggacaaaaatttggactagttacccaatttaga
ccttcatatttggcccctgtaattgctttattaagaggacttactgatcctatcgttggt
ttgaatatggggcaaacggctgaaaaagtcgcttataaatttaatattactcgcgcacaa
atggacgagtttgctgtgcaaagccatttgaaattagacgctgcttataatgaacatagg
atgtcagaggtaacccccattattgatagcaaagggcgaattcatcctcaagatgatgga
attcgtgtagattcaacagtagaaaaactagcgaaattaaaacctatttttgataaaaaa
tatggcatggtgactgcgggaaatagttctcaagttactgatggtgcctgtttattgttg
cttgctagtgcagaagcagttaaaaaacatggcttgcaagtaatagggcggatagtcgat
tctcaatgggcagctttagatccttctcaaatgggacttgggcctgttcatgctgctaca
cctattttacaaagacataagttaagacccgaagatatggattgttgggaaatcaatgag
gcttttgccgctcaagtattaggctgtgttgccgcatggagtgatgagcattattgtaaa
gaacagttgggtctaaaagaagcaatgggggctccatcattagacaaattaaatcgtgat
ggtggtgctgtagcggcaggtcatccaattggcgctagtggagctcgtattgtattacat
gtactaaaatcattagagcaaagaaatgaatcacgaggtatggctgccatttgtattggt
ggaggacaaggtggggctatgtatcttgaacgagttactgaggtgaacggacatgaataa

DBGET integrated database retrieval system