KEGG   Legionella fallonii: LFA_2262Help
Entry
LFA_2262          CDS       T03771                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lfa  Legionella fallonii
Pathway
lfa00900  Terpenoid backbone biosynthesis
lfa01110  Biosynthesis of secondary metabolites
lfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lfa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LFA_2262 (mvaA)
Enzymes [BR:lfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LFA_2262 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CEG57636
UniProt: A0A098G6L7
Position
I:2519891..2521189
Genome map
AA seq 432 aa AA seqDB search
MSIASNAEQLFSGFSKLSREERFQRLLALGAITPEDINFLKQGGIKNSNLAEKLIENVIG
YFQLPLGVATNFNIDGHDYVVPLAVEETSIIAALSKSAKWIRQHGEIKTWVEGDCILGQI
QLAKINDFEQFSRIFNENRLYLIEKANEDVAATMVKRGGGVKDLQLRHIKREDGHDMAVI
HLTMDSCDAMGANIINQVLEYLKTPIEQIAGEEVTMCILSNLNDQKLTTAQVTIRNIAPE
LGHKLQEASLFAEMDPYRAATHNKGVMNGIDPVLIATGNDWRAVEAGIHAYAARSGQYRA
ITRWRYQNETLTGELTAPIIVGTVGGVTSLHPTAKMCLRMMNISSANQLSRIIAAVGLVQ
NLGAIRALCTDGIIQGHMKLHIDNLLLVTGADENEIPVLKERLQKWLDLNKRVSVNNAHD
LLAEIRQTSIAI
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagcttctaatgcggaacagttatttagtggcttttcaaagctttcacgcgaa
gagcgattccaaagattattagctttaggcgctatcacgcccgaggatattaattttctc
aagcaaggtggtatcaaaaactcaaatctggctgaaaagttaatagaaaatgttataggc
tattttcaacttcctttaggagtagccaccaactttaatatcgatggtcatgactacgtt
gttcccttagccgttgaagaaacatcgattattgctgctttatccaaatcagcaaagtgg
ataagacaacacggcgaaataaaaacttgggttgaaggcgattgtattcttgggcaaatt
caattggccaaaatcaatgattttgaacaattttcccgtattttcaatgaaaatcgctta
tatcttatagaaaaagccaatgaagatgtagccgctactatggtcaaacgtggcggtggc
gttaaagatttgcaactacgccatataaaaagagaagatggccatgatatggcagtgatt
catctgactatggatagttgtgatgccatgggtgccaatattattaatcaagttcttgaa
tatttgaagacccccattgagcaaatagccggtgaagaagtcaccatgtgcattttatct
aatttaaatgatcagaaactgacaacagcacaagtgactatccgtaatattgctccagaa
ttaggccataaattacaggaagcctcattattcgcggaaatggatccttacagagctgct
actcacaataaaggagtaatgaatggcattgatccagtactcattgccacgggtaatgac
tggcgtgctgtagaagcgggaatacatgcatacgccgcacgtagcggccaatatagagcc
attacgcgttggcgttatcaaaatgagacgctcacaggggagttaactgcgccaattatt
gtaggcaccgtaggtggtgttacttccctacaccctaccgcgaaaatgtgtttacgtatg
atgaacattagctcagcaaaccaactatctcgaatcattgccgcggtcggactggttcag
aatttaggtgcaattagagccttatgcactgatggtattattcaaggacacatgaaatta
cacattgataatcttcttttagttactggagcagatgaaaatgagatccctgtgctaaaa
gaacgtctacaaaaatggcttgatttaaataaaagagtcagtgtaaataatgctcatgat
ttattagctgaaatcagacaaacatcgattgcgatatga

DBGET integrated database retrieval system