KEGG   Laceyella sacchari: C1X05_00735Help
Entry
C1X05_00735       CDS       T05304                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lfb  Laceyella sacchari
Pathway
lfb00450  Selenocompound metabolism
lfb00970  Aminoacyl-tRNA biosynthesis
lfb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C1X05_00735
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C1X05_00735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lfb01007]
    C1X05_00735
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lfb03016]
    C1X05_00735
Enzymes [BR:lfb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C1X05_00735
Amino acid related enzymes [BR:lfb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C1X05_00735
Transfer RNA biogenesis [BR:lfb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C1X05_00735
 Prokaryotic type
   Other AARSs
    C1X05_00735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f BCDHK_Adom3 ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AUS07523
UniProt: A0A2I7SNS1
Position
151066..153165
Genome map
AA seq 699 aa AA seqDB search
MRASPCLLGDAEIGWYRVKQSRPNYVGGIFYIVFERSGEKVSEQKQTFYLTTPIYYPSAK
LHIGHAYTTVAGDVIARYKRLRGFDVMYLTGTDEHGQKIQKKAQAEGKTPKAFVDEIVAG
IKELWKKLDISYDDFIRTTDERHKRVVQKIFKQLLEQGDIYLGEYEGWYCVDDEAFFTDR
QVQDGLCPDCGRPISKIKEKSYFFRMNKYADRLLRFYEENPGFIEPESRKNEMIQNFIKP
GLEDLSISRTTFDWGIKVPDDPEHVVYVWLDALTNYISALGYGVGDDAKYKKYWPADVHL
VGKEIVRFHTIYWPIFLMALGLPLPKKVFAHGWILVQGEKMSKSKGNVIDPVPLIERFGL
DAMRYFLMREVPFGSDGVFTPEAFVERLNADLANDLGNLLHRTLTMVEKYHQGVVPEMVE
GATEYDEAFRELALNTVKRVEAEMDKFQFSVAATAIWELVRAGNRYIEQTQPWNLAKDPG
KHHLLGSVLYHLLEVLRMVSIMIQPFMTQTPSKMWAQLGLEEGPQTSWESLAAFGGLRPG
TQTKKGNPIFPRLDAKEEIEAIYRMTTSATPAAEDRNTKQKEAKREEQKEMEGIIGIEDF
GKVDLRVAEVVAADRVPKADRLLKLQLDLGEEKRQVVSGIAEHYRPEELVGQKVICVTNL
KPVKLRGELSQGMILAASQGDRLVLATVSGDISNGSKVK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgagggcatcgccatgcttgttaggcgacgctgaaattgggtggtaccgcgtgaaacaa
tctcgccccaactatgtgggcgggattttttatattgtatttgaaaggagcggggaaaaa
gtgagtgaacagaaacaaaccttttaccttacgacacccatctattacccaagtgccaaa
ctacatatcggtcatgcttacactactgtagctggagatgtgatcgctaggtacaaacga
cttcggggtttcgacgtcatgtacttgaccggcacggatgaacatggtcagaaaatccag
aaaaaggcacaagcagaaggcaaaacaccgaaagcgtttgttgatgagatcgttgcgggt
attaaagagttgtggaaaaagctcgacatctcttatgacgatttcatccgcaccaccgat
gagcgccataagcgagtcgtacaaaaaatcttcaagcaactgttggagcagggagatatt
tacctcggtgagtatgaaggctggtattgtgtggacgacgaagcgtttttcacggaccgc
caagtccaggatgggctttgtcctgactgcggccgccccattagcaaaatcaaagagaag
agttacttcttccgcatgaacaaatacgccgaccgcctgttgcgtttctatgaggagaat
cccggtttcattgagccggaatcccgtaaaaacgagatgatccaaaacttcatcaaaccc
ggcttggaagacttgagcatttctcgcaccacgtttgattggggcatcaaagtgccggac
gatcctgagcatgtcgtttacgtgtggttggatgcgttgaccaattacatttctgcgctg
gggtacggcgttggcgatgacgctaagtataagaaatattggccagcggatgtgcacttg
gttgggaaagagattgttcgctttcacaccatttattggcccatctttttgatggcgctc
ggtctgccgttgccaaagaaagtgttcgcccatgggtggattttggtgcaaggggagaag
atgtccaaatccaaaggaaacgtgattgatccagttccgttgattgagcggtttggtttg
gatgcaatgcgttatttcctgatgagagaagtgccgtttggatcggatggcgttttcacc
ccagaagcgtttgtggaacggctgaatgccgatttggccaatgatttgggaaatctattg
caccgcaccttgaccatggttgaaaagtaccatcaaggggttgtgccggagatggtcgaa
ggcgctacggaatacgacgaggcgttccgggagttggcgctgaatacggtcaagcgtgtg
gaagcggagatggataaattccaattctctgttgccgctaccgccatttgggagttggta
cgggcagggaaccggtacatcgaacaaacccagccgtggaacttggctaaagatccaggc
aagcaccatctcctcggttcagtgctatatcatctgcttgaggtgctgagaatggtcagc
atcatgatccagccgttcatgacgcaaaccccgtccaagatgtgggcgcaattgggcttg
gaagaaggcccacagacttcatgggaaagcttggccgcgtttggcggattgcgtccggga
acccaaacgaaaaaaggaaatccgattttcccgcgcttggatgcgaaagaggagattgaa
gccatttatcggatgaccacttcagcaactccggccgcagaggatcggaacacaaaacaa
aaagaggcaaaacgggaggaacaaaaagagatggaaggaatcattggcatcgaagatttt
ggcaaagtagatttacgggtggcggaagttgtcgcagcggatcgcgtgcctaaagcggat
cgcctgttgaagttgcaactcgatttgggagaagagaaacggcaagtggtttcgggcatt
gccgagcattaccgtccggaagagttggtggggcaaaaggtgatttgcgtaacgaatttg
aagccggtcaaactgcgcggcgagctgtcccaaggcatgattttggcggcttctcaagga
gatcgcttggtgctagcgactgtgtcgggcgatatttctaacggctccaaagtgaagtag

DBGET integrated database retrieval system