KEGG   Laceyella sacchari: C1X05_09745Help
Entry
C1X05_09745       CDS       T05304                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
lfb  Laceyella sacchari
Pathway
lfb00620  Pyruvate metabolism
lfb00630  Glyoxylate and dicarboxylate metabolism
lfb01100  Metabolic pathways
lfb01110  Biosynthesis of secondary metabolites
lfb01120  Microbial metabolism in diverse environments
lfb01200  Carbon metabolism
Module
lfb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C1X05_09745
   00630 Glyoxylate and dicarboxylate metabolism
    C1X05_09745
Enzymes [BR:lfb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     C1X05_09745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AUS09105
UniProt: A0A2I7ST73
Position
1967247..1968860
Genome map
AA seq 537 aa AA seqDB search
MAPRRGSGLLRKVSCPERVEIIGPVTDSYAEVLTFSALQFIADLTRRFRDQRDRLLHNRK
ERSVKLKTELPDFLDETRAIREGNWSIAPLPQDLLDRRVEITGPAGDRKMVINALNSGAQ
GFMADFEDANSPTWHNTVQGQINLRDAIRGTLTYMSPQGKWYKVNPDPAVLHVRPRGWHL
DEKHVLVDGKPVPASLFDFGLYFYHNAKALVAKGSGPYFYLPKMESHLEARLWNDVFVYA
QQVKGIEQGTIKATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSYMKHLQNHRA
ILLPDRSLVTMTTPFMKAYTQLAIQTCHKRNAPCIGGMAAHIPSRKNPEATQRAFELVRA
DKEREAQAGHDGTWVAHPGLVQLAREVFDHWMPEPNQISRKQEEVTITQADLLRVPTGPI
TENGLRTNIRVGIHYIAAWLSGSGAVAIDNLMEDAATAEISRAQVWQWLRHPDASLEDGR
PITKELYQQLLQEEATRLREQLGSSHRLDMAIPLFSELVLSDEFTEFLTLPGYALLD
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaggaggggatccggtttgttgcgaaaagtatcatgcccggaaagagttgag
atcataggcccagtcactgattcctatgccgaagtgctcaccttctcagccttgcaattc
atcgctgatcttacacgacgcttccgcgatcaacgtgatcgcctgttgcataacagaaaa
gaacggtcggtaaaactaaagactgaactgcccgattttctggatgagacaagagccatt
cgggaaggaaattggtccatcgcccccttgccccaggatttgcttgaccggcgggtggag
atcaccggtcctgctggcgaccgcaaaatggtaatcaatgctctcaactccggagcccag
ggtttcatggccgattttgaagatgccaactcacccacttggcacaacaccgtgcaaggg
caaattaacttgcgtgacgcaattcgagggacactcacctacatgagtccccaaggaaaa
tggtataaagtaaaccctgatcctgctgtgcttcatgtacggccgcgcggatggcatctg
gatgaaaaacacgtccttgttgacggaaaaccggttccggccagcctgtttgatttcgga
ctttatttctaccacaatgcaaaggccttggtggccaaaggatcaggcccttatttttac
ctcccaaaaatggaaagccatttggaagcacgtttgtggaatgacgtatttgtttatgcc
caacaagtgaaagggattgaacaaggcaccatcaaagcgaccgtgttaatcgaaacgatc
ttggccgcgtttgaaatggatgaaatattgtacgaattaagagaacattcagccggatta
aactgcggccgctgggattatatcttcagttacatgaaacacttgcagaaccatcgtgcc
attctgttgcctgaccgctcgctggtcacgatgacaacccccttcatgaaagcttatacc
caattggcaatccaaacatgccacaagcgcaatgccccttgcattggcggaatggccgcc
cacattccgagcaggaaaaaccccgaggcgactcaacgggcatttgaattagtgcgcgcc
gataaagagagggaagcccaagccgggcatgatggcacatgggtagctcatcccggcctc
gtccaactggcccgggaagtgtttgatcactggatgccagaacccaatcaaatcagccga
aagcaagaagaagtgaccatcacgcaagccgacttgttgcgggtgcccaccggcccgatt
accgaaaacggactgcgaaccaacatccgtgtcggcatccactatatcgccgcttggtta
agcggttcaggggctgtggctatcgacaacctgatggaagatgcagccaccgctgaaatt
tctcgtgcgcaggtttggcaatggttgcgccatccggacgcctcactggaggacggacgg
ccgatcaccaaagagttatatcagcaattgttgcaagaagaagcgacccgtctgcgtgaa
cagctgggatcttcccatcgtttagacatggcgatccccctgttttccgaattggtgttg
agtgatgaattcacagagtttctgacattacccggctatgcgttattagattaa

DBGET integrated database retrieval system