KEGG   Laceyella sacchari: C1X05_13260Help
Entry
C1X05_13260       CDS       T05304                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
lfb  Laceyella sacchari
Pathway
lfb00860  Porphyrin and chlorophyll metabolism
lfb01100  Metabolic pathways
Module
lfb_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:lfb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C1X05_13260
Enzymes [BR:lfb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     C1X05_13260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AUS09701
UniProt: A0A2I7SUX7
Position
complement(2692355..2692960)
Genome map
AA seq 201 aa AA seqDB search
MKWVWIRHGETKANRDKRYCGQLDEPLTEVGKKQALQLSSQLADLKLDAIYASDLQRCAE
TAQAIKEAHPSLSIRFTPALRECSFGAWEGRTYEELMGTNPEHVGKWLENPFFHAPPDGE
TLRDLDQRLMAWVRQAIKRHRGETVCVVTHGGPMRWFWARMIRRDWESFWEPELQTGQGW
LVERIGTEWQVVRKFGEEREE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgggtttggattcggcacggggaaacgaaagctaatcgcgacaaaaggtactgc
ggacaactggatgaaccgttgacggaggttggaaagaagcaagcgttgcagctgtccagc
caattggcggatttgaagctggatgccatctatgccagcgatctgcagcgatgcgccgaa
acagcgcaagccatcaaagaggctcacccgtctctttccatccgtttcacgccggcattg
cgcgagtgctcatttggcgcttgggaagggcgaacctatgaagaactgatgggtactaat
cccgaacatgtaggcaaatggctggaaaaccctttttttcatgctcctccagacggtgaa
accctgcgagacctagaccagcgcttgatggcatgggttcggcaggcgatcaagcggcat
cgtggagagacagtttgcgttgtgacacatggtgggccgatgcgatggttttgggcgcgg
atgattcgccgcgattgggagtctttttgggagccggagttgcagacgggtcaaggctgg
ctggtagaacgtattggaacggagtggcaagtcgtgaggaagtttggggaagaacgggag
gagtga

DBGET integrated database retrieval system