KEGG   Leptospirillum ferrooxidans: LFE_0042Help
Entry
LFE_0042          CDS       T01809                                 

Definition
(GenBank) putative pyruvate synthase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00010  Glycolysis / Gluconeogenesis
lfc00020  Citrate cycle (TCA cycle)
lfc00620  Pyruvate metabolism
lfc00633  Nitrotoluene degradation
lfc00640  Propanoate metabolism
lfc00650  Butanoate metabolism
lfc00680  Methane metabolism
lfc01100  Metabolic pathways
lfc01120  Microbial metabolism in diverse environments
lfc01130  Biosynthesis of antibiotics
lfc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_0042
   00020 Citrate cycle (TCA cycle)
    LFE_0042
   00620 Pyruvate metabolism
    LFE_0042
   00640 Propanoate metabolism
    LFE_0042
   00650 Butanoate metabolism
    LFE_0042
  Energy metabolism
   00680 Methane metabolism
    LFE_0042
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LFE_0042
Enzymes [BR:lfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     LFE_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: BAM05772
UniProt: I0IKH3
Position
complement(49263..50270)
Genome map
AA seq 335 aa AA seqDB search
MEDLPTKNISLTLLREQQPRFTGLEAGHRACQGCGQALAARLVLEAAGPDTIIANATGCL
EIFSSSWPESAWRTPWIHSLFENTAAVASGIEAAMRAQGRSTRVLAFAGDGGTFDIGFQS
LSGMLERNHSVLYVCFDNEAYMNTGVQRSGSTPHGAWTTTSPVGSRTRGKKHYKKDLLSI
IAAHRIPYSATASIAYPSDLRSKVRKALGEEGSSFILIHSPCPLGWGHESHLAIEIDRLA
VETGLFPLIEMEGGELTHVMPIRKKRPVIDYIRPQERFRHLLEESDKAEEERNHLQALCD
FNIERYGLLLSSPEPSSRLDSQSADTVRRGGGRWT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaagatctgcccacaaagaacatttcactcactctccttcgtgaacagcagccgagg
tttacagggcttgaagcaggacatcgggcctgccagggttgcgggcaggccctggccgcc
cgattggtcctcgaagccgctggtccggatactattatcgcgaacgcaaccggatgcctg
gaaatcttcagctccagctggcccgagtccgcatggagaacgccgtggatacactccctg
tttgaaaacactgccgctgtcgcttccggcatagaagccgccatgagagcccagggacga
tccacacgggttctggctttcgccggagatggaggaacttttgatatcggatttcagtca
ctgtccgggatgctggaacgaaatcactcggttctttatgtctgcttcgataatgaagct
tatatgaatacaggcgtccaacgctcaggctccaccccacacggagcctggacaacaacc
tcccccgtcggctcccggaccagagggaaaaaacactacaaaaaagatcttttgtctatt
atagcggcccaccgcattccgtattctgcgacagcctcaatcgcctatccttccgatctt
cgatcgaaggtcagaaaagcgctcggagaagaaggatcctcatttatcctgattcattct
ccctgccctctggggtggggacatgaaagccatctggccatcgaaatcgatcgtcttgcc
gtggaaacaggactctttccactcatcgaaatggagggaggagagttgacacatgtgatg
cccatacggaaaaaacgccctgtcattgactacataaggccacaagaacgtttccgccac
cttctcgaagagtctgacaaggcggaagaagagcgaaaccacctccaggctctatgcgac
ttcaatattgaacgatacggattgctgctgagctctcccgaaccatcttcccgccttgat
agccaatccgcagacactgtcagaagaggcggcgggcgatggacatga

DBGET integrated database retrieval system