KEGG   Leptospirillum ferrooxidans: LFE_0046Help
Entry
LFE_0046          CDS       T01809                                 

Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00010  Glycolysis / Gluconeogenesis
lfc00051  Fructose and mannose metabolism
lfc00562  Inositol phosphate metabolism
lfc01100  Metabolic pathways
lfc01110  Biosynthesis of secondary metabolites
lfc01120  Microbial metabolism in diverse environments
lfc01130  Biosynthesis of antibiotics
lfc01200  Carbon metabolism
lfc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LFE_0046
   00051 Fructose and mannose metabolism
    LFE_0046
   00562 Inositol phosphate metabolism
    LFE_0046
Enzymes [BR:lfc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LFE_0046
Exosome [BR:lfc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LFE_0046
  Exosomal proteins of bladder cancer cells
   LFE_0046
  Exosomal proteins of melanoma cells
   LFE_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PRP4
Motif
Other DBs
NCBI-ProteinID: BAM05776
UniProt: I0IKH7
Position
complement(53229..54026)
Genome map
AA seq 265 aa AA seqDB search
MLLVANWKMNMTRAQINDYLDVLSASPIWPALEEAGIEIALAPSSVYLDHLVRSIREKEL
PIRVVAQDVSTRTSGAFTGEIGVPNLLDIGVSGVILGHSERRRFFGETDEDVCDKTDLCL
RAGLMPIICFGESSADRKSGRAFDVIKTQLQPVADRANLLREDGVYTALFLAYEPIWAIG
SGIVAGATDVCEVTAFGFDGFTWPERPKFLYGGSITSDNIVEISACDKLSGFLVGSSWLD
PKSLLHSAQKIASVIKEGSLSKRAH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttgtcgcaaactggaaaatgaacatgactcgggcccagatcaacgactacctt
gatgtcctgtcagcttcccctatctggccggcactggaagaagcggggatcgaaatcgcc
ctcgctccttccagcgtctacctcgatcatcttgtcaggtcgatccgggaaaaagaactc
cctatccgggttgtagcacaggacgtctcaacaagaacgtccggtgcctttacaggggag
atcggcgttcccaatcttctggatatcggagtcagcggggtcatactgggacattcagag
cgcagacggttttttggagaaaccgatgaggatgtttgcgacaagacagacctctgtctg
agggccggtctgatgccaatcatctgttttggagaatccagcgcagacagaaaatccgga
agggcattcgatgtcatcaaaacccagttgcaaccggttgccgacagggcgaacctgctt
cgtgaagatggcgtctatacagcccttttcctcgcctatgaaccgatctgggccattggc
tccggtatcgttgccggagcgacagatgtctgtgaagtcaccgcattcggatttgatggg
ttcacttggccagaacgacccaagtttctttatggaggatccattacctcagacaatatt
gttgaaatatccgcctgtgacaaattatccggattcctcgtgggaagttcctggctggat
ccaaaatcacttctgcattctgcccagaaaatcgcttctgtcatcaaggaaggctccctg
agcaagagagcacactga

DBGET integrated database retrieval system