KEGG   Leptospirillum ferrooxidans: LFE_0689Help
Entry
LFE_0689          CDS       T01809                                 

Definition
(GenBank) putative tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00260  Glycine, serine and threonine metabolism
lfc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lfc01100  Metabolic pathways
lfc01110  Biosynthesis of secondary metabolites
lfc01130  Biosynthesis of antibiotics
lfc01230  Biosynthesis of amino acids
Module
lfc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LFE_0689
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LFE_0689
Enzymes [BR:lfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LFE_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: BAM06404
UniProt: I0IMA5
Position
665003..665794
Genome map
AA seq 263 aa AA seqDB search
MMPRTLKKVRLSDKKVIPYLMAGDPDLPVTKRLLSEASKAGVWAVELGIPFSDPTADGPV
IQKAAIRALSDKTSLTKILSFLGEIPLSERPPIFIMTYFNLFLSLTIEEFIQEAGRVGGI
VGAVIPDLSFEDSKKVRKAFKAAGLALIPFISPTTSPSRIKKILATADGFIYFVSLLGTT
GKALTLSSTMEESVRNLRSQTKLPVCVGFGIQTPEMAKEILQFSDGVIVGSRLVQEEKDP
LEWGKLLRQFCEVARSMPSSQHQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatgccccggacccttaaaaaagtgagactctctgataaaaaagtcatcccatatctt
atggcgggagatccggatctcccggtgaccaagcgacttctctctgaagcgagcaaggca
ggtgtatgggctgttgaattgggaattcccttctctgacccgacggcagatggtccagtt
atccagaaggcggccatcagggccctatcggataaaacatcccttaccaaaattctctct
tttctgggagagattccgctttctgaaagacctcctatttttatcatgacctacttcaat
ctctttttgtcattgacgattgaggagtttatccaggaggccggtcgagttggcggtatc
gtcggggcagtgataccggatctgtcttttgaagactcaaagaaggtcaggaaagctttt
aaagcggcgggtttggctctcatcccgtttatatcaccgacgacaagcccgtcccgtata
aaaaaaattcttgcaacagcggatggattcatttactttgtatctttgctgggtacgact
ggaaaagcgctgaccttgtcgtcgacaatggaagagtcggtgaggaatcttcgttctcag
acgaaattgcctgtttgtgtcggttttggaattcagactccggaaatggcaaaagagatt
ctccagttttctgacggagtgattgttgggtccagattggttcaggaagaaaaggatccg
cttgagtggggaaaattgttgcgacaattttgcgaagtggccagatcgatgccttcttcg
caacatcaatag

DBGET integrated database retrieval system