KEGG   Leptospirillum ferrooxidans: LFE_1123Help
Entry
LFE_1123          CDS       T01809                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00260  Glycine, serine and threonine metabolism
lfc00750  Vitamin B6 metabolism
lfc01100  Metabolic pathways
lfc01110  Biosynthesis of secondary metabolites
lfc01120  Microbial metabolism in diverse environments
lfc01230  Biosynthesis of amino acids
Module
lfc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LFE_1123
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LFE_1123
Enzymes [BR:lfc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LFE_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: BAM06815
UniProt: I0ING6
Position
1136472..1137536
Genome map
AA seq 354 aa AA seqDB search
MSLPNWPGVIENYREFLSVSESTKIVTLKEGGTPLLPLLRIPDIIKAPISLYVKLEGQNP
TGSFKDRGMTLAVTKALEKGAKALICASTGNTSASAAAYGVRAGLKVYVVIPEGNIAKGK
LAQAVMHQSVVIQVQGLFDQALEVVRDVSKTHPVALVNSVNPDRIEGQQTVAFEICDVLG
SAPTFHFLPVGNAGNITASWMGFKKYRDIGRIAALPKMVGVQAEGAAPIVLGHVVPNPRT
IASAIRIGNPASWTGATNASVESGGEIIAASDEHILEAYRMLAREEGVFCEPASAASLAG
VIAYARKGLFRQGDVVVCTLTGHGLKDPETALSVPYTHISVPPSREAVLEVLGF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcccgaattggccaggcgtgatagagaactaccgggagtttttgtccgtatcc
gagtccaccaagattgtcaccctcaaggaaggtggcactccactccttccgttgctccgc
ataccggatatcatcaaggctccgatttccctttatgtgaagcttgaaggtcaaaacccg
acgggcagcttcaaggacagggggatgaccctcgctgtgacaaaagctttggaaaaggga
gcaaaagccctgatctgcgcatcgacagggaacacttcggcatcggcagccgcttatggt
gtgcgggcaggactcaaggtctatgtggtgattccagagggaaatatcgcaaagggtaaa
cttgcgcaggctgtcatgcaccagtctgtggtgattcaggtccagggtcttttcgaccag
gcacttgaagttgtccgggacgtttccaagacccatccggttgctttggtcaactccgtg
aatcccgacaggattgaaggccaacagactgtggcttttgaaatctgtgatgttctggga
agcgctccgaccttccatttccttccggttggaaatgccggaaacataacggcaagctgg
atgggtttcaaaaaataccgggatatcggacgtattgcggccctccccaaaatggtaggt
gttcaggccgaaggagccgcaccgatcgtactcggacatgttgtccccaaccccaggaca
atcgcatcagccatccgcatcggtaatcccgcatcctggactggggcaacaaacgcttct
gttgaatcggggggggagattattgcggcttccgatgagcatatcctggaagcgtacaga
atgctggccagggaagaaggggttttttgcgagcctgcttccgctgcttccttggcgggc
gtgattgcctatgcgagaaaaggactcttccgccagggtgatgttgttgtctgcacgttg
acaggacatggtctgaaggatcccgaaacagccttatcagttccttatacgcatatatcg
gttccgccttcaagagaggctgttcttgaggttctgggtttctga

DBGET integrated database retrieval system