KEGG   Leptospirillum ferrooxidans: LFE_1723Help
Entry
LFE_1723          CDS       T01809                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
lfc  Leptospirillum ferrooxidans
Brite
KEGG Orthology (KO) [BR:lfc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LFE_1723
Enzymes [BR:lfc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     LFE_1723
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     LFE_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAM07403
UniProt: I0IQ54
Position
1754127..1755158
Genome map
AA seq 343 aa AA seqDB search
MSPHILTNSEKPLAITMGDPGGIGPEVIVKSWLNPEIQKVDRIVIGDPEIMKDVARRYEP
SLVVRTITDAEEFSKDPGVMDVMIPSLDKPLESIITESNRLMAGRWSYACVRQGVELSMV
RKVAGIVTAPLNKKMLHAAGYQYPGHTELIAALTNTEHYGMMLVGGPLRVILVTTHIPFK
DIASKITKERVLETIRLAKQATEYLGLENPKIAVAALNPHAGEASLFGNEEATSIFPAIL
EARSEGIEVDGPIPADTLYAKAAQGRYSIVVSQYHDQGLIPLKMLSFGQGINVTVGIPII
RTSVDHGTAYDIVGKGIANPGSMTEAVKLAHELVLRVEKNTKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccccatattctcactaactctgaaaaaccacttgcaatcaccatgggagatccg
gggggaatcgggccggaggtgatcgtcaagtcctggttgaatcccgagattcaaaaagtc
gaccggattgtgattggtgacccggaaatcatgaaagatgtcgcccgacgttacgaaccc
tccctcgtggtcaggacaatcacagatgccgaagagttttcaaaagacccgggagtcatg
gatgtcatgattcccagtctggacaaaccactcgaatcaatcatcacggagtcaaacagg
ctcatggccggcaggtggtcctatgcctgtgtcagacagggagtggagctgtccatggtc
cgaaaggttgctggtattgtaacggcccccctgaacaaaaagatgcttcatgctgcaggc
tatcaatatcccggccacacagaactgatcgcagcactcacgaatacagaacattacggg
atgatgcttgtcggaggtccactcagggtcatcctcgttaccacacacatcccgtttaaa
gacatcgcttcaaaaatcacaaaggagagggttctggaaaccattcgccttgccaaacaa
gccaccgagtatctcggtcttgaaaacccgaagatcgcggttgccgcactgaacccgcat
gcgggagaggcttcactgttcgggaacgaggaggcaacgagcattttccccgccattctt
gaagccagatcagaaggaattgaagtcgatggccccattcctgcagatacgctttacgct
aaggcagcccaaggaagatactcgatcgtcgtctcccagtaccatgatcaaggcctcatt
cctctgaagatgctctcattcggccaaggcattaatgtcacagtcgggattcccatcatc
aggacctcagtggaccatggcacagcatacgatatcgttggaaaaggcattgccaatccg
ggatcaatgacagaagcggtcaagctagctcatgaacttgttctcagggttgagaaaaat
acaaaaaaatga

DBGET integrated database retrieval system