KEGG   Leptospirillum ferrooxidans: LFE_1789Help
Entry
LFE_1789          CDS       T01809                                 

Definition
(GenBank) putative UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00471  D-Glutamine and D-glutamate metabolism
lfc00550  Peptidoglycan biosynthesis
lfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LFE_1789
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LFE_1789
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lfc01011]
    LFE_1789
Enzymes [BR:lfc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     LFE_1789
Peptidoglycan biosynthesis and degradation proteins [BR:lfc01011]
 Precursor biosynthesis
  Amino acid ligase
   LFE_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C Pyr_redox Pyr_redox_2 Pyr_redox_3 Abhydrolase_9
Motif
Other DBs
NCBI-ProteinID: BAM07468
UniProt: I0IQB9
Position
complement(1826019..1827626)
Genome map
AA seq 535 aa AA seqDB search
MAVSETRMLSKISVNQEEATPKEKEQVMVLGAGRSGIAAARLAVYLGGDVTLKDENIDCL
SPLLKEQLSKEGIHLDLGKILKPLDFGTATKVIVSPGLPPEKWSGLAVPEYDSRVIGELE
WASALSPFPLLAVGGTNGKSTTSALAAHFLRACGLSVFLGGNFGTPLSEAVLSERKRIAQ
ELSPEYDAGVVEISSFQAETMSPVRSWFDPVVHLFLNITPDHLDRHPSEEAYRRAKWQSF
RGISPSHFTVFNGDPESGLYPLRKTPGRPAFFFASRKGASPELPVEEAPVFLLSEDGKTG
RVSGFPGQKGETEIWQLDGFSLPGLGNRQNLAASLLGTLIFLNEQRKIGKVRGQDSGDMP
FPEKTLLLESLSGFRGLPHRMEVIAEKNGICFINDSKATNVDATLMALKGFSVKSGNKGG
DDADARSLILIMGGRDKGASYFPLASPVKDLVRVLIVLGESREVIAKSLSSFCETIPVSS
MKMAVDVALSKGREGDTVLLSPGCSSYDMFHGYEERGNAFAMLVREALGVYRGGA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttcggagacacgaatgctttcaaagatttcagtcaatcaggaagaagcgact
cccaaggaaaaagaacaggtcatggtgcttggagcgggacgatcagggatagctgcggcc
aggctggctgtttatcttggtggggatgtgacattgaaggacgagaacatcgactgtctt
tctcctctcctcaaggagcagctatcaaaagagggcattcatctagaccttggaaaaatc
ctgaagccgctcgacttcggaacagccacgaaggtgattgtcagcccgggccttccccct
gaaaagtggtcagggcttgcggtccctgaatatgacagcagggtgattggagagctggaa
tgggcttcggcactttctccctttccacttcttgccgtggggggaacaaatggaaaatcg
acaacatctgcactggcggctcattttctaagagcatgcggtctatcggttttcctcgga
gggaactttggtacgcccctttcggaggcggttctgtcggaacgcaagagaatcgcacaa
gagttgtctcctgagtatgatgctggcgttgtcgaaatatcgagctttcaggcagaaacc
atgagtcctgtcagatcctggttcgatcctgttgtccatctttttctgaatattactcct
gatcatcttgaccgccatccttcagaggaagcgtatcgacgggcaaagtggcagtcattt
cgaggaatttcaccatctcattttactgtgttcaacggtgatccggagtcaggactctac
cctctccgaaaaactcccggtcgaccggcctttttctttgcgagccggaaaggagcctct
ccggaacttcctgttgaagaagctccggtctttcttctatcggaagacggaaagaccgga
agagtctcgggattccccggacaaaagggagaaacagagatatggcagcttgacggcttt
tctttgccgggtcttggaaatcgccaaaatcttgcagccagtcttttgggaacgctgatt
tttttaaatgagcagcgaaaaattgggaaagttcgaggccaggactccggagatatgccg
tttccagaaaagacattgcttttggaaagtctgtccggattcagagggctcccccatagg
atggaagtcatagcagaaaaaaatggcatctgtttcatcaatgattccaaggcaacaaat
gtggatgcgacattgatggcccttaaggggttttcagtgaagagcgggaacaagggcgga
gatgatgcagatgcaagatctctgatcctgattatgggtggacgtgacaagggtgcttcc
tattttccactggcctctccggtcaaggatcttgtcagggtgctgattgttcttggagag
tcaagggaggtgattgcaaagtccctttcctccttttgtgaaacgattccggtttcaagc
atgaaaatggctgtcgatgtcgccttatcgaaagggcgagagggagacacggtccttctt
tcgccgggttgttcaagctatgacatgttccacgggtatgaagagcgtggaaatgccttt
gccatgctggtgagggaagctctcggagtctataggggaggggcttga

DBGET integrated database retrieval system