KEGG   Leptospirillum ferrooxidans: LFE_1949Help
Entry
LFE_1949          CDS       T01809                                 

Definition
(GenBank) putative formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
lfc00670  One carbon pool by folate
lfc01100  Metabolic pathways
lfc01120  Microbial metabolism in diverse environments
lfc01200  Carbon metabolism
Module
lfc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lfc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LFE_1949
Enzymes [BR:lfc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     LFE_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: BAM07626
UniProt: I0IQS7
Position
complement(1994817..1996508)
Genome map
AA seq 563 aa AA seqDB search
MTLIDLESLARSLGVPSDRFHRFGPGRGKIDPRYLPSPSLGLSPDDSKVSSALYVLVTGM
TPTPLGEGKTTTSIGLSMALNRLGLRTVVTIRQPSMGPVFGIKGGGAGGGRSTIEPMDVL
NLHLTGDIHAVSSAHNLLASAIDNEFSHSNPLRIDPLSINYPRVVDLNDRPLRKVVIGLG
GRANGIPRETEFSIAVSSEVMAILALAKDYSDLSGRLSKITVGANVDGTPVTARDLGVDG
AMAALLREAFWPNLMATCEGTPAIVHGSPFANIAHGNSSVIGDWVALSGAQCVVTEAGFG
ADLGGEKFFDIKSPILGRGPNVAVLVATAKSLRMHGGLAETTAGKPIPEILDSPHPESVD
RGCANLRRQIENIRSFGVPVVVAINSHPQDSQEEWDIIRRHAIDAGASDAVVCSHFRDGS
EGALALARVVMETAKHHNGQVTPLYRREDSLEDKVTRIVTTMYGAKMASWSDRARKSLVV
AKSLGAETMPVCIAKTWASLSHDPALKGDPRGYVFPVTDVRAFTGAGFVTVYAGDVQTMP
GLPSRPAFRKIDLSPDGITRGMT
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgactttgatcgatttagaatcacttgcccgttccctcggtgttccatctgaccgattt
caccgcttcgggccaggcaggggaaaaattgacccccgttacttgccctctccatctctg
gggctttctcctgatgactcaaaagtttcttccgcactttatgtccttgtgacgggaatg
actcccactccgcttggagaaggaaaaaccaccacttccatcggcctctcgatggccttg
aaccgtcttggcttaaggacagttgtcacgattcgacagccttcaatggggcctgttttt
ggaatcaaggggggtggtgcaggaggaggaaggtcgaccattgaaccgatggatgtcctg
aacctccacctgacaggggatattcatgccgtttcatcggcacacaatcttctggcatcg
gccatcgacaatgaattctcccacagcaatccccttcggattgaccctctctccatcaac
tacccccgggtagtggatctgaatgatcgtcctctccggaaggtggtgatcggcctgggg
ggacgtgcgaacgggattccccgggaaacggaattttcgattgcggtgagttcggaagtg
atggcgattctggctttggcaaaagactattccgacctttcggggagactatctaaaatt
acggttggagcgaatgtcgatggcacccctgttacggcaagggatctgggtgtcgacggg
gcgatggcggcacttcttcgtgaggccttctggccgaatcttatggcgacttgcgagggc
acgcctgcgattgttcacggatcgccttttgcgaatattgcccatggaaactcttccgtc
atcggagactgggttgccctttcaggggcccaatgtgttgtgacggaggccggtttcggg
gctgatcttggcggggagaaattttttgacataaaatcccccattctcggaagggggccg
aatgtggccgttctggtcgctacggcaaagagcctccggatgcacggggggcttgcggag
accacggcgggcaaacctattccggaaattctggattcgccccatccagagtcggttgac
aggggatgcgcgaatcttcgtcgccaaatcgaaaatatccgctctttcggagttccggtc
gttgtggcgatcaactcccatccccaggattcacaagaagagtgggacattattcgccgg
cacgcaatcgatgcaggtgcttccgatgcggtggtctgttcacatttcagggacggtagc
gaaggagcgcttgcccttgcgcgggtcgtcatggaaacggctaaacaccataatggtcag
gtgactcccctttatcgccgggaagattccctggaagataaagtgactcgcattgtgaca
accatgtatggtgcaaaaatggcttcgtggtcggacagggccagaaaaagtctggttgtc
gccaaatctctcggggcagagacgatgccggtctgcattgccaagacatgggcttcgctt
tcacatgatccggctttgaaaggggatccccgtggctatgtttttccagtgacggatgtc
agggcgtttacaggggccggttttgtcactgtttatgcaggggatgtccagacgatgccc
ggcttgccttcaagacctgctttccggaagattgatctctctccggatggaataaccaga
ggcatgacatga

DBGET integrated database retrieval system