KEGG   Leptospirillum ferrooxidans: LFE_2287
Entry
LFE_2287          CDS       T01809                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
lfc  Leptospirillum ferrooxidans
Brite
KEGG Orthology (KO) [BR:lfc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lfc02044]
    LFE_2287
Secretion system [BR:lfc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LFE_2287
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: BAM07959
UniProt: I0IRR0
Position
2351922..2353301
AA seq 459 aa
MKSTKPIFWHQGLFLQPQHFQLTDAHTTGMTRPVLDTVLPFGWGVQTIDIQTTALGRGSV
QVNSLSMVLQDGSFVQFPGNAVIRPRSFEKDWTYRDKPLTIYAGLRRFRDQGKNVTTVPN
LDSDADTRFLSLADPEEVQDLYGEGPPASVKTLYFNVRLFWDNEIDNLEHYNLVPVAQVL
WEGGVIKPSPSFIPPSLSLSTSRNLSSLVQEIRNECASRSRQLEEFKTPREQKTEGMDAG
YMIYILALRTLNRYVPLLYHYAESDPVHPWLLYGTLRQMVGEVSTFSDRVNFLGETDQSG
EPLPPYDHEDIWGCLTKAQTVLFTLLNNLTVGPDLIIRLEKSDESFNGTLSQSFFSPRTR
YYLVVKTEGDPERESSSFMDNAKIGPPSIISSLIRRALPGVELTAMSGPPQGLPRRLNAQ
YFRIEPHDPVWDAIRQEEAIQVHWPGAPEGSMIDLIGVR
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaaatccacaaaaccgatcttctggcaccaaggacttttccttcagccccagcacttc
caactgaccgacgcccataccaccggaatgacccgcccggtcctcgacaccgttctgccc
tttggatggggagtccagacgatcgacatccagacgaccgccctcggacggggatcggtt
caggtcaactccctgtccatggtccttcaggacggaagcttcgtacagtttcccggaaac
gcagtcatccgaccccgttctttcgaaaaagactggacatacagggacaagccgctgacg
atctatgcgggtctccggcgcttcagggaccagggcaagaatgtcaccaccgtcccgaat
ctcgattctgatgcagacacccggtttctctcccttgccgaccccgaagaggtccaggac
ctttacggggaaggaccaccagcctccgtcaaaacactttatttcaatgtccgtctcttc
tgggacaacgaaatcgacaatctcgagcactataaccttgttcccgtggcgcaggtcctg
tgggagggaggggtcatcaagccaagcccttctttcatccctccctccctctccctgtcc
acctcccggaacctttcaagccttgtccaggaaatccggaatgaatgcgccagccgttcc
cggcagctcgaggagttcaagacccccagggagcagaagacggaaggaatggacgcagga
tacatgatctatatcctcgccctccgcaccctgaaccgttacgtccccctcctctatcac
tacgccgaaagcgaccctgttcatccatggctcctctacggaacactcaggcagatggtg
ggagaggtcagcacattttccgaccgggtcaattttctcggcgagaccgatcaatccgga
gagccccttcctccctatgatcacgaggatatctggggatgtctgaccaaagcccagacg
gtgctgtttacattgctgaacaacctgaccgtcggaccggatctgatcatccggctcgaa
aaaagcgacgaatccttcaatggaaccctttcccagtccttcttctctccccggacacgc
tattacctggtggtcaagaccgagggagatccggaacgggaaagctcctccttcatggac
aatgcgaaaatcggccctccctccatcatctcctccctgatcagaagagctctgcccggt
gtcgaactcaccgccatgagcggaccgccccagggtcttcccagaagactcaacgcccag
tatttccggatcgaaccgcatgacccggtctgggacgccatccgtcaggaggaggcgata
caggtccattggccgggagcacctgaaggttcaatgatcgatcttattggagtccgataa

DBGET integrated database retrieval system