KEGG   Leptospirillum ferrooxidans: LFE_2290
Entry
LFE_2290          CDS       T01809                                 

Definition
(GenBank) putative ImpA domain protein
  KO
K11910  type VI secretion system protein VasJ
Organism
lfc  Leptospirillum ferrooxidans
Brite
KEGG Orthology (KO) [BR:lfc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lfc02044]
    LFE_2290
Secretion system [BR:lfc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LFE_2290
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: BAM07962
UniProt: I0IRR3
Position
2357874..2359418
AA seq 514 aa
MNLESIRELGKKAIPGEFPAGRDVRELEGFLALQAEIDRSQSISASGAVDWKKVQKLSEE
LLDREGKDLLVACYLSVALTRTGGPPGFLAGLKVMADLVEDYWETLFPPLKRLRGRRNAI
SWWLEQQKEILPKLDNPPLSPREMADGREVARRLNRTLGDKDPEGPLLSPVIALLDALPV
LEPEPLQEIKEAVPPESSAPSPEPLEPVSRQEEPIAIPEEEPEDTLERIYVAMKIVSENL
LAGDPTDFRIYRTSRMSLWDPISVLPDSQDRVTRIPPPPHPLQSALESVLASGSPEDLIA
FSETQQPVYPFWLDLSFHEAMALEKMGESGQQAALALKGEISFLLKRLSGIESLSFSDNT
PFLSPEGKKWLESLHMGDQPPGGGETLASSALFEPVRLMIGDGRHEEAARRFEEIRKKAP
SARIRLHLDTEFLMEIAGRGRDFPVEIFALSLLRESDRIDLDLWEPELSKRVLPLLYRIF
SQSEEDELQKEAGHLMRRLVALDISSAIVTFQKR
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgaaccttgaatcgatcagagaacttggcaaaaaggcgatccccggagagttccctgcc
ggtcgcgatgttcgggagcttgagggctttctggctcttcaggcggaaatcgaccgaagc
cagtccatctccgcgtcaggagcggtcgactggaaaaaggtccagaaactctccgaagag
cttctcgacagggagggaaaagaccttctggtcgcctgctacctttccgtcgccctgacc
cgaaccgggggtccccccggttttctggccggcctcaaggtcatggccgacctcgtcgaa
gactattgggaaaccctttttccacccctgaaaagactgcggggaagacggaacgccatt
tcctggtggctcgaacagcaaaaggaaatccttccgaagctggacaatcctccactgtct
ccccgggagatggccgatggccgggaggtcgcccgtcgattgaaccggacattgggagac
aaagaccctgaaggcccccttctgagccctgtcattgcccttttggacgcccttcccgtc
ctggagccagagcctctccaggagataaaggaggctgtcccccccgagagttcagctccc
tctccggaacctttggaacccgtgtcccgtcaggaggagccgatcgctatcccggaggaa
gaaccggaagacactctggagcggatctatgtggccatgaaaatcgtttcggaaaatctt
ctggccggggatcccaccgatttccggatttatcgtacttccagaatgtccctgtgggac
ccgatctccgttctccccgactcccaggatcgggtcacccgcattccccctcctccccat
ccccttcagtccgcactggaatccgttctcgcctcgggcagtcccgaagacctgatcgcc
ttttcggaaacccagcaaccggtttaccccttctggctggatctgtccttccacgaggcc
atggcgcttgaaaagatgggcgaatccggccaacaggccgctcttgccctcaagggagag
atctccttcctgttaaaacggctttccggaatcgaatcactctctttctcggacaacact
cccttcctttctcccgaaggcaaaaaatggcttgaatctctccacatgggcgatcagccc
cccggagggggggagacgttggcttcatcagcgcttttcgagccggtgcggctgatgatt
ggcgatggacgacatgaagaagcggccagacgatttgaggagatccggaaaaaggcacct
tcggcccggatccggcttcacctggatacggagtttttgatggagatcgccggaaggggt
cgcgatttccccgttgaaatatttgcgctttccctcctccgggagagcgaccggatcgat
ctcgacctttgggaaccggagctctccaaaagggttctcccgctcctctaccggatcttt
tcgcaaagtgaagaggacgagctccagaaggaagccggccacctgatgcgccgtctagtc
gctctggacatctccagtgccatcgtaacattccagaagagatga

DBGET integrated database retrieval system