KEGG   Lactobacillus fermentum IFO 3956: LAF_0181Help
Entry
LAF_0181          CDS       T00699                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00900  Terpenoid backbone biosynthesis
lfe01110  Biosynthesis of secondary metabolites
lfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lfe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAF_0181
Enzymes [BR:lfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LAF_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: BAG26517
UniProt: B2GFC8
Position
225361..226638
Genome map
AA seq 425 aa AA seqDB search
MAKDWTHGFYKRSAQERRSLVKQASALSDQQAQTLANQATQLGDQLVENYLTDYHLPEGL
LVGLVVNGQDYILPMVTEEPSVIAAASNGSQRVAKSGGFVATAGPRALVGQVVLCDVVDF
GATKDWLLDHQEPILAVANDAHPSMQKRGAGAKGIRVRIEPPFVSLDLLIDVSEAMGANS
VNTMAEAVGAWLKEQGYQVLTAILSNLATDSLQTVTCQIDPAHLATSEMDGVTVAKRIAL
MSDLAQVDVYRATTHNKGIMNGIDALVLASGNDWRAIEAGAHAYAAKDGHYRGLATWQFK
DGRLVGELTLPMPIGVVGGSINLTPQSQINYQILQIKSAKELAGVIVAGGLAQNLAALRA
LATTGIQAGHMKLQYRSLALSVGATTAEAPVLAKQLAAAGHADRQVASELLAQLRKEAHD
GRRED
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggactggacccacggtttttacaagcggagtgcgcaggaacggcgtagcttg
gttaaacaagcgagcgcccttagtgatcagcaagcccaaaccctagccaaccaagccacc
cagctcggcgatcaactggtggaaaactacctaaccgactaccacctgcccgagggcctc
ttggtcgggttagtggtcaacggccaagactacatcctgccaatggtcaccgaggagcca
tcggtgattgccgccgctagcaacggtagccagcgggttgctaagagcggcggctttgta
gccacggcagggccccgggcgctggtggggcaagtcgtcttgtgtgacgtggtagacttt
ggcgccaccaaggactggctgctggaccaccaggaaccaatcctggcggtggccaatgac
gcccacccgtcgatgcaaaaacggggcgccggagccaaagggatccgggtacggattgaa
ccaccctttgttagcctcgacctcttgatcgacgtctccgaggcgatgggggccaattcg
gtcaacacgatggccgaagcggttggcgcctggctaaaggagcagggctaccaggtcctc
accgccatcttaagcaacctagccaccgacagcttacagacggtgacctgtcaaattgat
ccggcccacctggccacgagcgaaatggacggggtgacggtggccaagcggattgccttg
atgagtgacctggcccaggtggacgtttaccgggccaccacccacaacaaggggatcatg
aacgggatcgacgccctggtcctcgctagcggtaacgactggcgggcaatcgaagccggc
gcccatgcttacgccgccaaagacggccactaccgggggctggcgacctggcaatttaag
gacggccgcctggtcggggagctaaccctgccaatgccgatcggcgtggttggcggttcg
atcaatctgactccccaatcccagatcaattaccaaatattgcaaattaagagtgccaag
gaactggcgggtgtaatcgttgccgggggcttggcccaaaacttagcggccttgcgggcc
ctggccaccaccggtatccaagcggggcacatgaaactccagtaccgctccctagcactt
agcgtgggagcgacaaccgccgaggcgcccgtcctcgctaagcagttagcggcggcggga
cacgctgatcggcaggtagctagcgaactgctggcccaactcagaaaggaagcacacgat
ggcagaagagaagattga

DBGET integrated database retrieval system