KEGG   Lactobacillus fermentum IFO 3956: LAF_0190Help
Entry
LAF_0190          CDS       T00699                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00900  Terpenoid backbone biosynthesis
lfe01100  Metabolic pathways
lfe01110  Biosynthesis of secondary metabolites
lfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lfe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAF_0190
Enzymes [BR:lfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LAF_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAG26526
UniProt: B2GFD7
Position
235201..236052
Genome map
AA seq 283 aa AA seqDB search
MIVTEKAPAKINLALDTPMRYLDGLPRWNMVMNAVDLADYVTVEIHHRPQTIKVYTNSGF
LPNDQRNLAYQAAHILKTRFHQTDGVTIRIKKKIPVAAGLGGGSSDAAAVLRALNKAWRL
GLSLDELARLSLSIDSDVPFCVYSQTAHVTGHGEIVEPLPAFPHYWVVIAKPKLSVSTPV
ILRQINYERLVHPQTDQLVEAIKEGKFQESFQYMGNALEAVTMEAHPEIARLKERMQKLG
ADVAQMSGTGPSVFALCHAESRAKRIYNSLRGFCPEVYQVVLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgacggaaaaggcaccggccaagattaacttggccctcgatacgcccatgcgc
taccttgacggcctgccccgctggaacatggtgatgaacgccgttgacctggctgattac
gtcaccgtggagattcaccaccgaccacagacgatcaaggtttacaccaacagcggtttt
ttacccaatgaccaacgcaacctagcctaccaagccgcccacatcctaaagacccgcttt
caccagactgatggggttaccatccgaatcaaaaagaagattccggtggcggccggcctc
ggtggcgggtcttcggacgcggcggccgtcttgcgggccctcaataaggcctggcgcctt
ggtttatcgttagacgagttggcgcgcttatccttatcaatcgattccgacgtgccattt
tgcgtgtactcccaaacggcccacgtgaccggccacggggagatcgtggaacccctgccg
gcctttccccactactgggtggtgattgccaaacccaagctatcagtctcgaccccggtt
atcttacgccagattaattacgagcgtttggtccacccgcaaacggaccagctggtggaa
gccatcaaggaaggaaagtttcaggagagctttcagtacatgggtaacgccctagaggcg
gtgaccatggaggcccaccccgaaatcgcccgtttaaaggaacggatgcaaaaattaggg
gccgacgtggcacagatgagcgggactggtcccagtgtcttcgccttgtgccacgccgaa
tcacgggccaagcgcatttataacagcctgcgtggcttttgcccggaggtctaccaagtc
gtcttgttataa

DBGET integrated database retrieval system