KEGG   Lactobacillus fermentum IFO 3956: LAF_0531Help
Entry
LAF_0531          CDS       T00699                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00471  D-Glutamine and D-glutamate metabolism
lfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LAF_0531
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lfe01011]
    LAF_0531
Enzymes [BR:lfe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     LAF_0531
Peptidoglycan biosynthesis and degradation proteins [BR:lfe01011]
 Precursor biosynthesis
  Racemase
   LAF_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Glycos_transf_1 AAA_26
Motif
Other DBs
NCBI-ProteinID: BAG26867
UniProt: B2GB35
Position
629069..629875
Genome map
AA seq 268 aa AA seqDB search
MDNRPIGVMDSGLGGLSVVRVIQQKLPNEEVIFVGDQGHFPYGTKDQAEVRQLALSIGAF
LLKHDVKMMVVACNTATAAALPALQAALPIPVIGVIEPGARAALAQDKKGPIGVIATTAT
TTAGAYPATIERLAPGTPVIAKATQPMVEIVEHGQTGTAKAQEVVSEQLMTFKEHPVKTL
IMGCTHFPFLAPEISKAVGPTVALVDPAKETVATAKSWLEQHQAMGNHAHPNYHLYSTGN
LPDLRAGVNKWLLSGHFDLGTAQIEEGD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcgcccaattggagtgatggattctggcttggggggcctttcagtcgtccgg
gttatccagcaaaaactacccaacgaagaggtcatcttcgtgggcgaccaaggtcacttc
ccgtacggaaccaaggatcaagcggaggtccgtcaactggcgctttcgattggtgctttt
ttactcaagcatgacgtaaagatgatggtcgtggcctgcaatacggcgacggcggccgca
ctgccggccctgcaagcggcgctcccaattcccgtaattggggtcattgagcccggcgcc
cgggcggccctggcccaggataaaaagggaccgattggggtgatcgccaccacggcaacc
accacggccggcgcctacccagctacgatcgaacggctagcgccgggtaccccggtcatt
gcaaaggccacccagccaatggtcgaaatcgttgagcacggccagaccgggacggcgaag
gcccaagaagtggttagtgaacagctaatgacctttaaagagcacccggtaaaaaccctg
attatgggctgcacccacttcccatttttggccccggaaataagtaaggcggtcggacca
acggtggccttagtcgacccggctaaggaaacggtggccacggccaagtcctggctggaa
cagcaccaagcaatgggtaaccacgcccaccccaactaccacctatattcaacgggaaac
ctccctgacttaagggccggggtgaataagtggttgttgtcggggcactttgacttagga
accgcccaaattgaagagggggattaa

DBGET integrated database retrieval system