KEGG   Lactobacillus fermentum IFO 3956: LAF_0943Help
Entry
LAF_0943          CDS       T00699                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lfe  Lactobacillus fermentum IFO 3956
Pathway
lfe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LAF_0943
Enzymes [BR:lfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LAF_0943
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LAF_0943
    1.1.1.-  
     LAF_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Pyr_redox_2 F420_oxidored UDPG_MGDP_dh_N Pyr_redox 2-Hacid_dh_C 3HCDH_N AstA
Motif
Other DBs
NCBI-ProteinID: BAG27279
UniProt: B2GC97
Position
1098494..1099546
Genome map
AA seq 350 aa AA seqDB search
MKAAVWHGAKDIRVEDVDLKPTKDNEVVVKVAWTGICGSDLHEYQEGPIFIPVGHKDKLT
GGEAPVTLGHEFCGVIEKVGKDVTKFKVGDHVSVNPTVTHGKVPDNVDVYDGYSFIGLAC
DGGLAPLVNIPEENLYLLPKDFPLRIAATIEPTAVAVQAIKEGGLKFGENVAIFGAGPIG
VLVAAAAKAAGASKIIVSDLSEVRLKKALEMGATDVIKSDQEDAVKKIKELVPGGVDVSF
EVAGVKPTFDQAIEATKARGTMVIVAIYGHPIEFNPMQLTNTGVKITSTIAYSRETFQQT
VDLVTKGSLVVEPVITKEITIDQVVSDGFEALTNDKAQAKILINVDGEDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtttggcatggtgcaaaagacattcgggttgaagatgttgatctgaaa
ccaactaaggataacgaagtggtggttaaggttgcctggactggaatttgtgggagtgac
ctccacgaataccaagagggaccaatcttcatcccggtcggccacaaggataaattaacc
ggtggtgaagctcctgtgaccttgggccacgaattttgcggggtaattgaaaaggttggt
aaagacgttaccaagtttaaggttggcgaccacgttagcgttaacccgactgtcacccac
ggcaaggtgcccgacaacgttgacgtatacgatggctactccttcatcggacttgcttgc
gatggtggtttagcgccgttagttaacatcccggaagaaaacctctacctacttccaaag
gacttcccgctgcggattgcagccaccattgaaccaacggcggtggccgttcaagccatc
aaggaaggtggcctcaagtttggtgaaaacgtggccatcttcggggctgggccaattggg
gtcttggtagcggcggcggccaaggcggccggggcctccaagatcattgtttccgacctg
tcagaggttcgtttgaagaaggcccttgaaatgggggcgaccgacgtcatcaagtccgac
caagaagacgccgtaaagaagattaaagagctcgttccgggcggggtcgacgtctccttt
gaagtggctggggtaaagccaacctttgaccaagccatcgaagccactaaggcacggggt
acgatggtaattgtggccatttacggccacccaatcgaatttaacccaatgcagctaacc
aataccggggttaagatcaccagcacaatcgcttactcccgggaaaccttccaacaaacg
gtcgacctggttaccaagggctcgttggttgtggaaccggtcatcaccaaggaaatcacg
atcgaccaagtggtatccgatgggtttgaagccctcaccaatgataaggcccaagcaaag
attttgatcaacgtcgatggcgaagacgactag

DBGET integrated database retrieval system